SimulationCraft 1015-01

for World of Warcraft 10.2.0.52038 PTR (hotfix 2023-11-03/52038, git build f486e91d50)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)779,499760,057729,643719,852718,551707,726680,495470 T31_4p460 T31_4p447+470 2p_2p447+460 2p_2p470 T31_2p460 T31_2p447 T30 4p
Created with Highcharts 4.2.3 Priority Target/Boss Damage 141,937138,418132,785131,201131,012129,168122,149470 T31_4p460 T31_4p447+470 2p_2p470 T31_2p447+460 2p_2p460 T31_2p447 T30 4p
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)3,8583,8413,8193,7783,7743,7253,688470 T31_2p470 T31_4p460 T31_2p447+470 2p_2p460 T31_4p447+460 2p_2p447 T30 4p

Additional Raid Information

447 T30 4p : 680495 dps, 122149 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
680495.0 680495.0 339.1 / 0.050% 55040.2 / 8.1% 49358.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 14.0 Astral Power 0.00% 54.1 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447 T30 4p 680495
Astral Smolder 78722 11.6% 341.9 0.94s 68854 0 Periodic 702.5 33508 0 33508 0.0% 78.1%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 341.90 0.00 702.54 702.54 246.30 0.0000 2.0000 23541403.67 23541403.67 0.00% 16754.54 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 702.54 509 888 33508.20 3290 131151 33551.42 29204 38790 23541404 23541404 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 19982 2.9% 5.1 64.79s 1165673 1192166 Direct 754.5 5004 10580 7917 52.2%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 754.51 0.00 0.00 0.00 0.9778 0.0000 5972751.82 5972751.82 0.00% 1192166.03 1192166.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.76% 360.37 227 525 5003.52 2631 16052 5008.30 4359 5779 1802843 1802843 0.00%
crit 52.24% 394.15 256 569 10579.84 5263 32104 10589.72 9620 12230 4169909 4169909 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [O]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2967 0.4% 16.8 17.58s 52813 0 Direct 16.8 41606 82781 52801 27.2%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.83 16.83 0.00 0.00 0.00 0.0000 0.0000 889100.58 889100.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.80% 12.26 2 26 41606.31 27597 160192 41472.05 27850 94236 509977 509977 0.00%
crit 27.20% 4.58 0 14 82781.14 55195 320384 81741.67 0 297274 379124 379124 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2868 0.4% 33.7 8.59s 25467 0 Direct 33.6 20064 40108 25539 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.72 33.62 0.00 0.00 0.00 0.0000 0.0000 858736.21 858736.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 24.44 9 44 20064.19 19533 22677 20062.95 19746 20809 490372 490372 0.00%
crit 27.31% 9.18 0 21 40108.27 39067 45353 40102.99 0 43102 368364 368364 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 70596 10.4% 3.0 1.06s 7044388 7550255 Direct 6.0 7108 14209 10545 48.4%
Periodic 1795.9 8296 16825 11732 40.3% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1795.93 1795.93 0.00 0.9332 0.9924 21133163.27 21133163.27 0.00% 11838.60 7550254.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.63% 3.10 0 6 7108.25 7039 8031 7006.24 0 8031 22021 22021 0.00%
crit 48.37% 2.90 0 6 14209.42 14077 16063 13925.60 0 16063 41237 41237 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.71% 1072.40 804 1366 8295.93 6604 13527 8294.81 8086 8517 8896455 8896455 0.00%
crit 40.29% 723.53 538 929 16825.41 13207 27054 16826.16 16318 17498 12173451 12173451 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82635) 0.0% (12.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 13763 2.0% 183.5 1.82s 22449 0 Direct 183.0 14462 30424 22507 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 183.51 183.04 0.00 0.00 0.00 0.0000 0.0000 4119685.34 4119685.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.60% 90.79 51 136 14462.38 10642 26502 14465.07 13457 15548 1313092 1313092 0.00%
crit 50.40% 92.25 58 137 30423.66 21284 53003 30442.03 28394 32693 2806594 2806594 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 13810 2.0% 184.7 1.81s 22378 0 Direct 184.3 14427 30338 22435 50.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 184.72 184.25 0.00 0.00 0.00 0.0000 0.0000 4133662.89 4133662.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.67% 91.51 52 135 14426.95 9868 26502 14428.32 13486 15506 1320191 1320191 0.00%
crit 50.33% 92.74 56 141 30337.63 19737 53003 30354.21 28331 33261 2813472 2813472 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 29295 4.3% 15.4 19.71s 571096 0 Direct 91.9 61345 128955 95445 50.4%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.35 91.87 0.00 0.00 0.00 0.0000 0.0000 8768528.58 8768528.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.56% 45.53 20 76 61344.62 33900 213345 61348.96 48909 75648 2792937 2792937 0.00%
crit 50.44% 46.34 25 78 128954.60 67800 446003 129040.63 99234 157872 5975591 5975591 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy5
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Crashing Star 25766 3.8% 92.1 3.32s 83697 0 Direct 91.9 53913 113340 83919 50.5%

Stats Details: Crashing Star

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.15 91.90 0.00 0.00 0.00 0.0000 0.0000 7712339.59 7712339.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.51% 45.50 16 75 53913.15 36826 98896 53926.08 48408 61972 2453085 2453085 0.00%
crit 50.49% 46.40 20 75 113339.87 73651 197793 113401.57 103391 129160 5259255 5259255 0.00%

Action Details: Crashing Star

  • id:408310
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:5.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:408310
  • name:Crashing Star
  • school:astral
  • tooltip:
  • description:{$@spelldesc405511=Shooting Stars has a {$s1=20}% chance to instead call down a Crashing Star, dealing {$408310s1=0} Astral damage to the target and generating {$=}{{$408310m2=50}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 223255 32.8% 105.1 2.82s 635373 621191 Direct 1767.1 25399 53719 37796 43.8%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.11 1767.05 0.00 0.00 0.00 1.0228 0.0000 66786754.11 66786754.11 0.00% 621191.23 621191.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.22% 993.49 728 1283 25398.86 6146 96482 25441.29 23421 28106 25232966 25232966 0.00%
crit 43.78% 773.56 545 1001 53718.73 12293 192964 53797.04 48837 58900 41553788 41553788 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:71.92
  • if_expr:variable.starfall_condition1
    aoe
    [P]:33.19
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 131647 19.3% 106.9 2.74s 368650 251589 Direct 647.2 39687 81015 60872 51.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.86 647.18 0.00 0.00 0.00 1.4653 0.0000 39395322.13 39395322.13 0.00% 251589.04 251589.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.74% 315.44 225 422 39686.80 6169 99521 39682.51 35949 43475 12518217 12518217 0.00%
crit 51.26% 331.75 233 431 81015.06 12339 198042 81018.77 74119 88948 26877105 26877105 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [Q]:107.37
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 60280 8.9% 1.0 0.00s 18035505 19166318 Direct 1.0 5597 11191 7152 27.8%
Periodic 1808.9 7142 14851 9967 36.6% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1808.88 1808.88 0.00 0.9415 0.9921 18035504.81 18035504.81 0.00% 10045.09 19166317.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.16% 0.72 0 1 5597.31 5564 5629 4038.81 0 5629 4039 4039 0.00%
crit 27.84% 0.28 0 1 11190.94 11128 11259 3115.93 0 11259 3116 3116 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.36% 1146.07 842 1450 7141.98 5457 12297 7143.35 6955 7378 8185163 8185163 0.00%
crit 36.64% 662.80 494 850 14851.11 10915 24595 14856.44 14401 15633 9843187 9843187 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5458) 0.0% (0.8%) 8.3 31.87s 197151 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.29 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2851 0.4% 8.3 31.87s 102980 0 Direct 49.8 13511 27003 17164 27.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.29 49.76 0.00 0.00 0.00 0.0000 0.0000 854032.62 854032.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.93% 36.29 7 94 13510.72 13150 15266 13510.73 13201 14528 490294 490294 0.00%
crit 27.07% 13.47 1 37 27002.95 26300 30532 27004.52 26300 29471 363739 363739 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2607 0.4% 15.9 15.60s 49069 0 Direct 95.5 6428 12847 8178 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.92 95.50 0.00 0.00 0.00 0.0000 0.0000 780981.09 780981.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.74% 69.46 14 171 6428.28 6257 7264 6428.17 6257 6877 446515 446515 0.00%
crit 27.26% 26.04 4 76 12846.63 12514 14528 12848.05 12514 13759 334467 334467 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 2085 0.3% 26.3 10.44s 23827 23779 Direct 26.2 17245 34481 23957 38.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.32 26.18 0.00 0.00 0.00 1.0020 0.0000 627127.03 627127.03 0.00% 23779.13 23779.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.06% 15.98 4 28 17245.32 12632 27784 17218.81 15112 19073 275639 275639 0.00%
crit 38.94% 10.19 0 24 34480.59 25264 54691 34424.36 0 40457 351489 351489 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [N]:24.43
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447 T30 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.86s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [M]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 67.76s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.35s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 16.4 7.0 18.9s 13.4s 9.8s 53.73% 55.84% 7.0 (27.0) 15.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.4s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s
  • uptime_min/max:49.39% / 57.52%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.38%
  • balance_of_all_things_arcane_2:5.73%
  • balance_of_all_things_arcane_3:6.16%
  • balance_of_all_things_arcane_4:6.70%
  • balance_of_all_things_arcane_5:7.06%
  • balance_of_all_things_arcane_6:7.43%
  • balance_of_all_things_arcane_7:7.58%
  • balance_of_all_things_arcane_8:7.68%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.9s 29.7s 7.9s 27.25% 30.54% 0.0 (0.1) 10.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 49.1s
  • trigger_min/max:3.9s / 49.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.71% / 29.99%

Stack Uptimes

  • balance_of_all_things_nature_1:3.37%
  • balance_of_all_things_nature_2:3.38%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.41%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.42%
  • balance_of_all_things_nature_7:3.43%
  • balance_of_all_things_nature_8:3.44%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.4s 70.4s 10.8s 10.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 320.1s
  • trigger_min/max:12.0s / 320.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.05%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.6s 70.4s 45.6s 33.77% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.4s / 352.9s
  • trigger_min/max:12.0s / 320.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 313.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.77%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 323.0s
  • trigger_min/max:12.0s / 323.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.21%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.6s 70.3s 44.4s 32.81% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 349.4s
  • trigger_min/max:12.0s / 323.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 286.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:32.81%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.9s 69.9s 10.8s 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 318.7s
  • trigger_min/max:12.0s / 318.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.78%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.8s 69.9s 45.4s 33.42% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 344.4s
  • trigger_min/max:12.0s / 318.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 292.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.42%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.2s 50.0s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 348.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.0s
  • uptime_min/max:47.99% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.7s 14.9s 20.5s 90.47% 91.62% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 71.8s
  • trigger_min/max:0.0s / 58.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:86.59% / 94.34%

Stack Uptimes

  • eclipse_lunar_1:90.47%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.3s 38.3s 19.2s 52.85% 55.04% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.2s
  • trigger_min/max:12.0s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.17% / 59.77%

Stack Uptimes

  • eclipse_solar_1:52.85%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.1s 306.1s 27.3s 12.97% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.0s
  • trigger_min/max:300.0s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.78% / 17.90%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.97%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.2s 65.2s 7.9s 13.52% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 90.4s
  • trigger_min/max:60.0s / 90.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.87% / 15.77%

Stack Uptimes

  • fury_of_elune_1:13.52%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.3s 38.3s 19.2s 52.85% 55.69% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.2s
  • trigger_min/max:12.0s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.17% / 59.77%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.85%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.1s 91.1s 19.5s 24.05% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.1s
  • trigger_min/max:90.0s / 121.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s
  • uptime_min/max:20.57% / 27.04%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.21%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.22%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.23%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.50% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.0s 69.3s 1.0s 0.87% 1.28% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 335.6s
  • trigger_min/max:0.0s / 335.6s
  • trigger_pct:15.07%
  • duration_min/max:0.0s / 8.1s
  • uptime_min/max:0.00% / 5.81%

Stack Uptimes

  • owlkin_frenzy_1:0.87%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.8 33.9s 33.9s 29.8s 91.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.5s / 47.7s
  • trigger_min/max:20.5s / 47.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.5s
  • uptime_min/max:87.46% / 94.93%

Stack Uptimes

  • primordial_arcanic_pulsar_5:6.90%
  • primordial_arcanic_pulsar_10:6.70%
  • primordial_arcanic_pulsar_15:7.39%
  • primordial_arcanic_pulsar_20:8.66%
  • primordial_arcanic_pulsar_25:8.78%
  • primordial_arcanic_pulsar_30:8.13%
  • primordial_arcanic_pulsar_35:8.59%
  • primordial_arcanic_pulsar_40:9.04%
  • primordial_arcanic_pulsar_45:9.79%
  • primordial_arcanic_pulsar_50:9.15%
  • primordial_arcanic_pulsar_55:8.44%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.0 5.4 17.2s 13.4s 7.1s 42.62% 41.82% 5.4 (5.4) 17.5

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.2s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s
  • uptime_min/max:38.11% / 45.98%

Stack Uptimes

  • solstice_1:42.62%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 105.1 0.0 140.9s 2.8s 284.5s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.6s
  • trigger_min/max:0.7s / 8.9s
  • trigger_pct:99.99%
  • duration_min/max:0.4s / 358.0s
  • uptime_min/max:98.31% / 99.47%

Stack Uptimes

  • starfall_1:5.10%
  • starfall_2:32.39%
  • starfall_3:41.81%
  • starfall_4:15.90%
  • starfall_5:3.32%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 20.9 84.2 14.5s 2.8s 14.0s 97.38% 0.00% 43.1 (43.1) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.7s
  • trigger_min/max:0.8s / 8.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.20% / 99.37%

Stack Uptimes

  • starlord_1:13.10%
  • starlord_2:17.45%
  • starlord_3:66.83%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.5 3.0 13.0s 11.4s 1.9s 13.93% 0.00% 3.0 (3.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 54.1s
  • trigger_min/max:0.0s / 53.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s
  • uptime_min/max:4.34% / 27.07%

Stack Uptimes

  • umbral_embrace_1:13.93%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.2 48.3 48.1s 5.5s 43.3s 90.21% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.0s
  • uptime_min/max:71.91% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.21%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.0s 45.3s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 220.4s
  • trigger_min/max:0.0s / 217.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.8s
  • uptime_min/max:5.29% / 58.68%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.0s 21.2s 49.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 0.72% 0.0s 0.0s 1.1s
Astral Smolder 71.40% 61.59% 81.50% 4.0s 0.0s 41.0s
Incarnation (Total) 52.85% 47.17% 59.77% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 32.56% 29.83% 35.75% 11.8s 0.0s 12.0s
Lunar Eclipse Only 37.62% 29.73% 44.58% 8.7s 0.0s 15.0s
No Eclipse 9.47% 5.56% 13.10% 2.3s 0.0s 6.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.1640.00030.39026.4505.47875.584

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.32100.0%0.000.0%0.000.0%0.000.0%
Starfire2.222.1%0.000.0%42.2539.2%63.3958.8%
Starfall29.079.8%0.000.0%109.2536.9%157.4953.2%
Fury of Elune27.703.7%0.000.0%118.0315.6%608.7880.7%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447 T30 4p
Crashing StarAstral Power92.14460.1611.01%4.990.530.11%
Fury of EluneAstral Power80.74241.745.78%2.990.470.20%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.35457.5010.94%29.803.090.67%
Shooting Stars (Moonfire)Astral Power183.51366.708.77%2.000.310.08%
Shooting Stars (Sunfire)Astral Power184.72369.138.83%2.000.310.08%
StarfireAstral Power107.871997.7247.79%18.5257.332.79%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.32263.196.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447 T30 4p
StarfallAstral Power 105.624144.75100.00%39.2439.4316113.57
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 678140.0 3203.07 3688.54 2932426.4 532686.1 -14985.0 678140.0
Astral Power 20.0 13.95 13.77 62.1 55.1 0.0 100.0

Statistics & Data Analysis

Fight Length
447 T30 4p Fight Length
Count 6709
Mean 299.62
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.2816
5th Percentile 246.22
95th Percentile 353.53
( 95th Percentile - 5th Percentile ) 107.31
Mean Distribution
Standard Deviation 0.4185
95.00% Confidence Interval ( 298.80 - 300.44 )
Normalized 95.00% Confidence Interval ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 503
0.1% Error 50291
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1004
DPS
447 T30 4p Damage Per Second
Count 6709
Mean 680495.04
Minimum 634212.20
Maximum 737189.15
Spread ( max - min ) 102976.95
Range [ ( max - min ) / 2 * 100% ] 7.57%
Standard Deviation 14172.6847
5th Percentile 658575.71
95th Percentile 704555.97
( 95th Percentile - 5th Percentile ) 45980.26
Mean Distribution
Standard Deviation 173.0307
95.00% Confidence Interval ( 680155.90 - 680834.17 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1667
0.1 Scale Factor Error with Delta=300 1714700
0.05 Scale Factor Error with Delta=300 6858797
0.01 Scale Factor Error with Delta=300 171469910
Priority Target DPS
447 T30 4p Priority Target Damage Per Second
Count 6709
Mean 122149.46
Minimum 109038.35
Maximum 136013.01
Spread ( max - min ) 26974.66
Range [ ( max - min ) / 2 * 100% ] 11.04%
Standard Deviation 3617.1615
5th Percentile 116445.16
95th Percentile 128305.61
( 95th Percentile - 5th Percentile ) 11860.45
Mean Distribution
Standard Deviation 44.1610
95.00% Confidence Interval ( 122062.91 - 122236.01 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3369
0.1 Scale Factor Error with Delta=300 111692
0.05 Scale Factor Error with Delta=300 446766
0.01 Scale Factor Error with Delta=300 11169134
DPS(e)
447 T30 4p Damage Per Second (Effective)
Count 6709
Mean 680495.04
Minimum 634212.20
Maximum 737189.15
Spread ( max - min ) 102976.95
Range [ ( max - min ) / 2 * 100% ] 7.57%
Damage
447 T30 4p Damage
Count 6709
Mean 203609093.76
Minimum 157375306.01
Maximum 248674043.83
Spread ( max - min ) 91298737.81
Range [ ( max - min ) / 2 * 100% ] 22.42%
DTPS
447 T30 4p Damage Taken Per Second
Count 6709
Mean 3688.18
Minimum 984.60
Maximum 7154.46
Spread ( max - min ) 6169.86
Range [ ( max - min ) / 2 * 100% ] 83.64%
HPS
447 T30 4p Healing Per Second
Count 6709
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447 T30 4p Healing Per Second (Effective)
Count 6709
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447 T30 4p Heal
Count 6709
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447 T30 4p Healing Taken Per Second
Count 6709
Mean 3195.94
Minimum 627.19
Maximum 7024.68
Spread ( max - min ) 6397.49
Range [ ( max - min ) / 2 * 100% ] 100.09%
TMI
447 T30 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447 T30 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447 T30 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.15 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 71.92 starfall,if=variable.starfall_condition1
0.00 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
M 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
N 24.43 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
O 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
P 33.19 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
Q 107.37 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
R 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMDEOLPQQLQLQLQLQQKLPQPQQLQQLQLQLQKLPQPQQLQLQLQLNNPQPQQPQLQLQQLOLNNLQLQLQQKLLQNNLQQLQFLQQELLPQQLQNLNQKLQPQPQQLQNKLNPQQPOQQLQKLLLQLNNQLQLQQLQPQNNPQLQQKLPQPQQQLQLLNFNLQMEPQPQOQLQKLPPQLQLQQLQKLPQPQQQQLQKPPQLNNQLQLQQKLPQPQQNLNLQQKLOQLQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447 T30 4p 0.0/100: 0% astral_power
Pre precombat 1 food 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447 T30 4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:00.944 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:01.886 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.827 aoe J moonfire enemy3 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:03.767 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:04.708 aoe M incarnation_chosen_of_elune Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:04.708 default D potion Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:04.708 default E use_items Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:04.708 aoe O fury_of_elune Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:05.531 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.353 aoe P starfall Fluffy_Pillow 58.2/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.146 aoe Q starfire Fluffy_Pillow 32.2/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.290 aoe Q starfire Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.435 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.200 aoe Q starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.347 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.112 aoe Q starfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.257 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.024 aoe Q starfire Fluffy_Pillow 62.2/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.168 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:15.933 aoe Q starfire Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.078 aoe Q starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.222 aoe K cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:18.222 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.079 aoe P starfall Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:19.903 aoe Q starfire Fluffy_Pillow 24.8/100: 25% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.092 aoe P starfall Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:21.886 aoe Q starfire Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.030 aoe Q starfire Fluffy_Pillow 38.2/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.176 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:24.940 aoe Q starfire Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.086 aoe Q starfire Fluffy_Pillow 75.6/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.232 aoe L starfall Fluffy_Pillow 96.8/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.998 aoe Q starfire Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.145 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.909 aoe Q starfire Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.053 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.821 aoe Q starfire Fluffy_Pillow 70.2/100: 70% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.967 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.967 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.825 aoe P starfall Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.648 aoe Q starfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.837 aoe P starfall Fluffy_Pillow 57.2/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:36.629 aoe Q starfire Fluffy_Pillow 22.2/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:37.775 aoe Q starfire Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:38.919 aoe L starfall Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:39.685 aoe Q starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:40.831 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:41.826 aoe Q starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:43.315 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:44.308 aoe Q starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:45.798 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:46.716 aoe N wrath Fluffy_Pillow 43.4/100: 43% astral_power primordial_arcanic_pulsar(45), starfall(4), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:47.723 aoe N wrath Fluffy_Pillow 53.4/100: 53% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:48.732 aoe P starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:49.862 aoe Q starfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:51.489 aoe P starfall Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:52.575 aoe Q starfire Fluffy_Pillow 8.6/100: 9% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:54.146 aoe Q starfire Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:55.716 aoe P starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:56.763 aoe Q starfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:58.138 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
0:59.058 aoe Q starfire Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:00.434 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:01.354 aoe Q starfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.729 aoe Q starfire Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:04.104 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:05.131 aoe O fury_of_elune Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:06.119 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:07.108 aoe N wrath Fluffy_Pillow 43.0/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:08.062 aoe N wrath Fluffy_Pillow 64.0/100: 64% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.107 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:10.239 aoe Q starfire Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:11.876 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:12.970 aoe Q starfire Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:14.607 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:15.698 aoe Q starfire Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:17.335 aoe Q starfire Fluffy_Pillow 67.6/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:18.972 aoe K cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:18.972 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_aerwynn_static, corrupting_rage
1:20.198 aoe L starfall Fluffy_Pillow 45.8/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:21.375 aoe Q starfire Fluffy_Pillow 32.8/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:23.072 aoe N wrath Fluffy_Pillow 54.0/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:24.119 aoe N wrath Fluffy_Pillow 64.0/100: 64% astral_power owlkin_frenzy, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:25.166 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(8), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:26.212 aoe Q starfire Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:27.222 aoe Q starfire Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:28.734 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:29.745 aoe Q starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:31.257 default F natures_vigil 447 T30 4p 81.6/100: 82% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:31.257 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:32.268 aoe Q starfire Fluffy_Pillow 40.6/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:33.643 aoe Q starfire Fluffy_Pillow 75.8/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:35.018 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:35.018 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
1:36.045 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
1:37.032 aoe P starfall Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(90)
1:37.986 aoe Q starfire Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(90)
1:39.476 aoe Q starfire Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:40.965 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:41.959 aoe Q starfire Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:43.447 aoe N wrath Fluffy_Pillow 67.4/100: 67% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:44.540 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
1:45.632 aoe N wrath Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:46.723 aoe Q starfire Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
1:48.361 aoe K cancel_buff Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
1:48.361 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
1:49.585 aoe Q starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
1:51.349 aoe P starfall Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
1:52.526 aoe Q starfire Fluffy_Pillow 25.8/100: 26% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
1:54.223 aoe P starfall Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
1:55.357 aoe Q starfire Fluffy_Pillow 6.0/100: 6% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:56.994 aoe Q starfire Fluffy_Pillow 27.2/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:58.630 aoe L starfall Fluffy_Pillow 52.4/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:59.720 aoe Q starfire Fluffy_Pillow 12.4/100: 12% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:01.356 aoe N wrath Fluffy_Pillow 63.6/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:02.449 aoe K cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:02.449 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power primordial_arcanic_pulsar(45), starfall, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:03.672 aoe N wrath Fluffy_Pillow 35.6/100: 36% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:04.850 aoe P starfall Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:06.027 aoe Q starfire Fluffy_Pillow 6.6/100: 7% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:07.725 aoe Q starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:09.422 aoe P starfall Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:10.555 aoe O fury_of_elune Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:11.547 aoe Q starfire Fluffy_Pillow 31.0/100: 31% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:13.036 aoe Q starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:14.526 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:15.444 aoe Q starfire Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:16.819 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:16.819 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:17.846 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:18.834 aoe L starfall Fluffy_Pillow 51.0/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:19.786 aoe Q starfire Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:21.161 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:22.078 aoe N wrath Fluffy_Pillow 42.2/100: 42% astral_power primordial_arcanic_pulsar(25), starfall(5), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:23.086 aoe N wrath Fluffy_Pillow 52.2/100: 52% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:24.096 aoe Q starfire Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:25.607 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:26.616 aoe Q starfire Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:28.126 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:29.136 aoe Q starfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:30.647 aoe Q starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:32.283 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.505 aoe Q starfire Fluffy_Pillow 41.0/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:35.267 aoe P starfall Fluffy_Pillow 60.2/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:36.443 aoe Q starfire Fluffy_Pillow 17.2/100: 17% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:38.139 aoe N wrath Fluffy_Pillow 36.4/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:39.274 aoe N wrath Fluffy_Pillow 46.4/100: 46% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:40.407 aoe P starfall Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:41.539 aoe Q starfire Fluffy_Pillow 25.4/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.052 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.061 aoe Q starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:45.575 aoe Q starfire Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:47.089 aoe K cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:47.089 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:48.220 aoe P starfall Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:49.209 aoe Q starfire Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:50.634 aoe P starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:51.584 aoe Q starfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:52.958 aoe Q starfire Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:54.334 aoe Q starfire Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:55.709 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:56.628 aoe Q starfire Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:58.117 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:59.112 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.204 aoe N wrath Fluffy_Pillow 47.0/100: 47% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:01.298 default F natures_vigil 447 T30 4p 57.0/100: 57% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:01.298 aoe N wrath Fluffy_Pillow 57.0/100: 57% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:02.391 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_pip_static, corrupting_rage
3:03.613 aoe Q starfire Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord, best_friends_with_pip_static, corrupting_rage
3:05.377 aoe M incarnation_chosen_of_elune Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:05.377 default E use_items Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:05.377 aoe P starfall Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:06.446 aoe Q starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:07.991 aoe P starfall Fluffy_Pillow 65.4/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:09.022 aoe Q starfire Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:10.510 aoe O fury_of_elune Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:11.549 aoe Q starfire Fluffy_Pillow 74.6/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:13.037 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:14.030 aoe Q starfire Fluffy_Pillow 73.0/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:15.518 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:15.518 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:16.631 aoe P starfall Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:17.700 aoe P starfall Fluffy_Pillow 47.0/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:18.730 aoe Q starfire Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:20.218 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
3:21.211 aoe Q starfire Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:22.699 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:23.691 aoe Q starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:25.179 aoe Q starfire Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:26.667 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:27.662 aoe Q starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:29.151 aoe K cancel_buff Fluffy_Pillow 92.2/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:29.151 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:30.264 aoe P starfall Fluffy_Pillow 59.2/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:31.334 aoe Q starfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:32.877 aoe P starfall Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:33.908 aoe Q starfire Fluffy_Pillow 14.4/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:35.397 aoe Q starfire Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:36.885 aoe Q starfire Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:38.371 aoe Q starfire Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:39.859 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:40.853 aoe Q starfire Fluffy_Pillow 64.2/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:42.342 aoe K cancel_buff Fluffy_Pillow 83.4/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:42.342 aoe P starfall Fluffy_Pillow 83.4/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:43.456 aoe P starfall Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord, umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:44.524 aoe Q starfire Fluffy_Pillow 17.4/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:46.067 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:47.021 aoe N wrath Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:47.940 aoe N wrath Fluffy_Pillow 50.6/100: 51% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:48.949 aoe Q starfire Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:50.463 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:51.473 aoe Q starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:52.985 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:53.994 aoe Q starfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:55.369 aoe Q starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:56.742 aoe K cancel_buff Fluffy_Pillow 87.4/100: 87% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:56.742 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:57.769 aoe P starfall Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:58.756 aoe Q starfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
4:00.181 aoe P starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
4:01.132 aoe Q starfire Fluffy_Pillow 20.6/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:02.622 aoe Q starfire Fluffy_Pillow 41.8/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:04.110 aoe N wrath Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:05.105 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:06.196 aoe N wrath Fluffy_Pillow 30.0/100: 30% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:07.287 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:08.380 aoe Q starfire Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:10.016 aoe Q starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:11.652 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:11.652 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:12.876 aoe O fury_of_elune Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:14.051 aoe Q starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:15.812 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall, starlord, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:16.988 aoe Q starfire Fluffy_Pillow 66.0/100: 66% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 33907 32293 28583
Intellect 2089 0 13192 12395 9716 (5819)
Spirit 0 0 0 0 0
Health 678140 678140 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13192 12395 0
Crit 27.03% 20.82% 2847
Haste 23.03% 23.03% 3708
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 13720 12891 0
Mastery 27.57% 27.57% 6991
Armor 4288 4288 4288
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 464.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 447, stats: { 664 Armor, +2395 Sta, +605 Crit, +269 Mastery, +635 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 447, stats: { 581 Armor, +2395 Sta, +596 Haste, +278 Mastery, +635 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447 T30 4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=447,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=447,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=464.25
# gear_stamina=28583
# gear_intellect=9716
# gear_crit_rating=2847
# gear_haste_rating=3708
# gear_mastery_rating=6991
# gear_versatility_rating=747
# gear_armor=4288
# set_bonus=tier30_2pc=1
# set_bonus=tier30_4pc=1

447+460 2p_2p : 719852 dps, 131012 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
719851.9 719851.9 359.1 / 0.050% 64997.8 / 9.0% 52846.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.8 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+460 2p_2p 719852
Astral Smolder 98638 13.7% 373.3 0.86s 79112 0 Periodic 734.6 40200 0 40200 0.0% 81.7%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 373.26 0.00 734.58 734.58 285.57 0.0000 2.0000 29529231.30 29529231.30 0.00% 20099.49 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.58 555 944 40200.34 3339 203634 40250.48 35214 47066 29529231 29529231 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20102 2.8% 5.1 64.76s 1174887 1200557 Direct 754.0 5064 10757 7979 51.2%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 753.98 0.00 0.00 0.00 0.9788 0.0000 6015993.62 6015993.62 0.00% 1200557.50 1200557.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.79% 367.89 213 527 5064.47 2673 16219 5073.56 4422 5806 1863085 1863085 0.00%
crit 51.21% 386.09 253 556 10756.81 5346 32438 10761.91 9667 12403 4152909 4152909 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2976 0.4% 16.9 16.82s 52843 0 Direct 16.9 41306 83171 52854 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.90 16.90 0.00 0.00 0.00 0.0000 0.0000 893207.68 893207.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.43% 12.24 2 26 41306.50 27597 160192 41077.19 27872 95531 505731 505731 0.00%
crit 27.57% 4.66 0 15 83171.39 55195 320384 82149.59 0 313792 387477 387477 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2876 0.4% 33.8 8.62s 25469 0 Direct 33.7 20062 40100 25539 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.84 33.75 0.00 0.00 0.00 0.0000 0.0000 861813.46 861813.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.67% 24.52 9 46 20061.64 19533 22677 20060.92 19733 20832 491950 491950 0.00%
crit 27.33% 9.22 0 24 40099.69 39067 45353 40098.00 0 43329 369863 369863 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 72243 10.0% 3.0 1.08s 7216581 7743113 Direct 6.0 7213 14416 10714 48.6%
Periodic 1800.6 8451 17148 11988 40.7% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1800.55 1800.55 0.00 0.9322 0.9909 21649742.73 21649742.73 0.00% 12114.88 7743112.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.41% 3.08 0 6 7212.53 7139 8146 7115.25 0 8146 22248 22248 0.00%
crit 48.59% 2.92 0 6 14416.22 14278 16292 14148.76 0 16292 42029 42029 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.32% 1068.13 799 1361 8450.85 6700 13661 8449.67 8220 8699 9026482 9026482 0.00%
crit 40.68% 732.42 523 952 17147.64 13400 27322 17147.77 16632 17650 12558984 12558984 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (65474) 0.0% (9.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 17703 2.5% 232.7 1.48s 22801 0 Direct 232.1 14677 30902 22861 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 232.67 232.07 0.00 0.00 0.00 0.0000 0.0000 5305118.35 5305118.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.56% 115.01 66 161 14676.72 10809 26778 14678.34 13746 15754 1687946 1687946 0.00%
crit 50.44% 117.06 72 165 30901.52 21618 53556 30916.64 29012 33375 3617172 3617172 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 17768 2.5% 234.2 1.48s 22727 0 Direct 233.6 14636 30813 22786 50.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.24 233.64 0.00 0.00 0.00 0.0000 0.0000 5323694.76 5323694.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.62% 115.93 71 163 14635.73 10020 26778 14636.18 13735 15613 1696670 1696670 0.00%
crit 50.38% 117.71 74 163 30812.95 20039 53556 30827.21 29081 32971 3627025 3627025 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 30004 4.2% 15.6 19.48s 577668 0 Direct 93.1 62160 130893 96571 50.1%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.56 93.11 0.00 0.00 0.00 0.0000 0.0000 8991159.79 8991159.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.94% 46.50 20 77 62160.36 34420 225325 62187.12 49609 77585 2890116 2890116 0.00%
crit 50.06% 46.61 23 77 130893.37 68840 450650 130909.05 100540 167794 6101044 6101044 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy3
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 224208 31.1% 103.5 2.87s 648521 633347 Direct 1768.9 25408 53912 37958 44.0%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.53 1768.90 0.00 0.00 0.00 1.0240 0.0000 67142332.00 67142332.00 0.00% 633346.53 633346.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.97% 990.03 733 1286 25408.07 6241 91144 25451.79 23331 28003 25154135 25154135 0.00%
crit 44.03% 778.87 568 1020 53911.70 12481 189960 53986.79 49495 60374 41988197 41988197 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.32
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.21
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 162920 22.6% 116.6 2.53s 418390 296457 Direct 705.8 43774 93078 69141 51.4%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.63 705.79 0.00 0.00 0.00 1.4113 0.0000 48797459.37 48797459.37 0.00% 296457.27 296457.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.55% 342.66 243 453 43773.62 6260 198085 43780.94 38631 49937 14999654 14999654 0.00%
crit 51.45% 363.13 268 486 93077.81 12520 396171 93100.90 82043 104421 33797806 33797806 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.37
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.80
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 61438 8.5% 1.0 0.00s 18401049 19575584 Direct 1.0 5677 11353 7260 27.9%
Periodic 1813.5 7246 15107 10143 36.9% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1813.49 1813.49 0.00 0.9405 0.9906 18401048.65 18401048.65 0.00% 10237.80 19575583.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.07% 0.72 0 1 5676.93 5644 5710 4091.26 0 5710 4091 4091 0.00%
crit 27.93% 0.28 0 1 11353.37 11287 11420 3171.21 0 11420 3171 3171 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.15% 1145.14 853 1452 7245.52 5537 12419 7246.98 7044 7527 8296961 8296961 0.00%
crit 36.85% 668.35 500 889 15107.32 11075 24838 15112.26 14581 15760 10096825 10096825 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5490) 0.0% (0.8%) 8.3 32.36s 197636 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2870 0.4% 8.3 32.36s 103328 0 Direct 50.0 13509 27001 17223 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 49.96 0.00 0.00 0.00 0.0000 0.0000 860429.93 860429.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.48% 36.22 3 84 13509.06 13150 15266 13507.80 13226 14485 489229 489229 0.00%
crit 27.52% 13.75 1 37 27000.79 26300 30532 27003.44 26410 29746 371201 371201 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2619 0.4% 16.0 15.82s 49078 0 Direct 96.0 6427 12845 8180 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.00 96.01 0.00 0.00 0.00 0.0000 0.0000 785319.38 785319.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 69.79 13 160 6427.22 6257 7264 6426.37 6290 6848 448563 448563 0.00%
crit 27.31% 26.22 3 65 12845.17 12514 14528 12845.57 12569 13848 336756 336756 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3487 0.5% 26.1 10.48s 40258 52042 Direct 26.0 29103 58155 40486 39.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.10 25.95 0.00 0.00 0.00 0.7736 0.0000 1050782.26 1050782.26 0.00% 52042.11 52042.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.82% 15.78 5 28 29103.27 12813 55563 29046.24 21394 36669 459370 459370 0.00%
crit 39.18% 10.17 1 22 58155.04 25625 106496 58065.54 29883 81098 591412 591412 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.18
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+460 2p_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.06s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 48.40s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.17 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.40s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.32s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.6 5.5 17.6s 13.6s 9.5s 55.72% 57.56% 5.5 (18.1) 17.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:0.0s / 37.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:50.83% / 59.14%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.78%
  • balance_of_all_things_arcane_2:6.18%
  • balance_of_all_things_arcane_3:6.64%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.50%
  • balance_of_all_things_arcane_7:7.61%
  • balance_of_all_things_arcane_8:7.67%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.1 0.0 30.1s 30.0s 7.9s 26.89% 29.92% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.8s
  • trigger_min/max:4.7s / 47.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.47% / 29.94%

Stack Uptimes

  • balance_of_all_things_nature_1:3.33%
  • balance_of_all_things_nature_2:3.34%
  • balance_of_all_things_nature_3:3.35%
  • balance_of_all_things_nature_4:3.36%
  • balance_of_all_things_nature_5:3.37%
  • balance_of_all_things_nature_6:3.37%
  • balance_of_all_things_nature_7:3.38%
  • balance_of_all_things_nature_8:3.39%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 69.5s 69.5s 10.8s 10.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 327.2s
  • trigger_min/max:12.0s / 327.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.30%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.93%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 111.9s 69.5s 45.0s 33.31% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.7s / 332.6s
  • trigger_min/max:12.0s / 327.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.31%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.4s 69.4s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 334.2s
  • trigger_min/max:12.0s / 334.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.52%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.4s 69.4s 44.9s 33.20% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 355.9s
  • trigger_min/max:12.0s / 334.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 291.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.20%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.8s 69.8s 10.8s 10.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 326.6s
  • trigger_min/max:12.0s / 326.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.24%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.2s 69.8s 45.2s 33.49% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.0s
  • trigger_min/max:12.0s / 326.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 288.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.49%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.2s 58.6s 50.5s 80.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 332.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.4s
  • uptime_min/max:38.78% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.33%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.2 20.6s 21.5s 2.2s 10.85% 20.52% 0.2 (0.3) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.07% / 14.91%

Stack Uptimes

  • dreamstate_1:7.30%
  • dreamstate_2:3.55%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 8.0 23.9s 15.0s 21.2s 93.02% 93.71% 8.0 (8.0) 12.2

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 69.8s
  • trigger_min/max:0.0s / 57.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.9s
  • uptime_min/max:89.96% / 95.90%

Stack Uptimes

  • eclipse_lunar_1:93.02%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.1 0.0 38.4s 38.4s 19.1s 52.27% 54.18% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.2s
  • trigger_min/max:12.0s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.71% / 59.63%

Stack Uptimes

  • eclipse_solar_1:52.27%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.8s 305.8s 27.3s 12.91% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.4s
  • trigger_min/max:300.0s / 325.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.85%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.91%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.7s 64.7s 7.9s 13.50% 0.00% 75.8 (75.8) 5.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 89.2s
  • trigger_min/max:60.0s / 89.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.70% / 15.60%

Stack Uptimes

  • fury_of_elune_1:13.50%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.1 0.0 38.4s 38.4s 19.1s 52.27% 54.89% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.2s
  • trigger_min/max:12.0s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.71% / 59.63%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.27%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.1s
  • trigger_min/max:90.0s / 121.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.37% / 26.97%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.7s 69.0s 0.9s 0.77% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 337.7s
  • trigger_min/max:0.0s / 337.7s
  • trigger_pct:15.06%
  • duration_min/max:0.0s / 6.1s
  • uptime_min/max:0.00% / 4.94%

Stack Uptimes

  • owlkin_frenzy_1:0.77%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.4 34.4s 34.4s 30.2s 91.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.7s / 47.2s
  • trigger_min/max:21.7s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.1s
  • uptime_min/max:87.81% / 95.04%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.22%
  • primordial_arcanic_pulsar_10:6.70%
  • primordial_arcanic_pulsar_15:7.70%
  • primordial_arcanic_pulsar_20:8.31%
  • primordial_arcanic_pulsar_25:8.50%
  • primordial_arcanic_pulsar_30:8.17%
  • primordial_arcanic_pulsar_35:8.69%
  • primordial_arcanic_pulsar_40:9.09%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.92%
  • primordial_arcanic_pulsar_55:8.89%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.3 15.6s 13.6s 6.6s 43.77% 42.95% 3.3 (3.3) 19.3

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.8s
  • trigger_min/max:0.0s / 37.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.39% / 47.31%

Stack Uptimes

  • solstice_1:43.77%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.5 0.0 143.1s 2.9s 296.1s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.2s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:6.2s / 357.9s
  • uptime_min/max:98.32% / 99.49%

Stack Uptimes

  • starfall_1:5.61%
  • starfall_2:33.60%
  • starfall_3:41.97%
  • starfall_4:14.31%
  • starfall_5:3.06%
  • starfall_6:0.33%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.6 14.5s 2.9s 13.9s 97.50% 0.00% 41.2 (41.2) 5.9

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.0s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.51% / 99.42%

Stack Uptimes

  • starlord_1:12.81%
  • starlord_2:17.95%
  • starlord_3:66.74%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.9 2.6 12.8s 11.4s 1.6s 12.40% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.5s
  • trigger_min/max:0.0s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:3.54% / 23.68%

Stack Uptimes

  • umbral_embrace_1:12.40%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.1s 90.14% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 330.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.0s
  • uptime_min/max:70.51% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.14%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.1s 45.4s 16.5s 23.59% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 251.2s
  • trigger_min/max:0.0s / 220.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.2s
  • uptime_min/max:4.84% / 61.20%

Stack Uptimes

  • wafting_devotion_1:23.59%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.6s 23.8s 47.8s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.84% 0.0s 0.0s 1.1s
Astral Smolder 73.82% 64.33% 84.56% 4.2s 0.0s 49.4s
Incarnation (Total) 52.27% 46.71% 59.63% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.00% 28.93% 34.78% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.76% 32.99% 47.06% 9.5s 0.0s 15.0s
No Eclipse 6.94% 4.10% 10.04% 1.7s 0.0s 4.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.9510.00029.24925.3626.26075.414

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.10100.0%0.000.0%0.000.0%0.000.0%
Starfire2.402.0%0.000.0%49.8342.4%65.4155.6%
Starfall21.167.1%0.000.0%119.0740.2%155.8852.6%
Fury of Elune20.832.8%0.000.0%143.6419.1%589.5178.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+460 2p_2p
Fury of EluneAstral Power80.79241.615.85%2.990.770.32%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.56464.9211.25%29.872.000.43%
Shooting Stars (Moonfire)Astral Power232.66465.0511.25%2.000.280.06%
Shooting Stars (Sunfire)Astral Power234.23468.1911.33%2.000.280.06%
StarfireAstral Power117.632208.2253.43%18.7733.071.48%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.10260.996.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+460 2p_2p
StarfallAstral Power 103.944096.01100.00%39.4139.5616392.13
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 695320.0 3226.28 3725.15 2620648.9 545688.1 11108.6 695320.0
Astral Power 20.0 13.78 13.60 36.4 53.1 0.0 100.0

Statistics & Data Analysis

Fight Length
447+460 2p_2p Fight Length
Count 8084
Mean 299.94
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.2700
5th Percentile 246.50
95th Percentile 353.37
( 95th Percentile - 5th Percentile ) 106.87
Mean Distribution
Standard Deviation 0.3812
95.00% Confidence Interval ( 299.19 - 300.69 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 502
0.1% Error 50149
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1003
DPS
447+460 2p_2p Damage Per Second
Count 8084
Mean 719851.86
Minimum 671874.19
Maximum 793306.96
Spread ( max - min ) 121432.77
Range [ ( max - min ) / 2 * 100% ] 8.43%
Standard Deviation 16471.2688
5th Percentile 693368.34
95th Percentile 747403.72
( 95th Percentile - 5th Percentile ) 54035.38
Mean Distribution
Standard Deviation 183.1951
95.00% Confidence Interval ( 719492.80 - 720210.92 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2012
0.1 Scale Factor Error with Delta=300 2315996
0.05 Scale Factor Error with Delta=300 9263984
0.01 Scale Factor Error with Delta=300 231599585
Priority Target DPS
447+460 2p_2p Priority Target Damage Per Second
Count 8084
Mean 131012.40
Minimum 117186.45
Maximum 148591.86
Spread ( max - min ) 31405.42
Range [ ( max - min ) / 2 * 100% ] 11.99%
Standard Deviation 4017.6865
5th Percentile 124534.68
95th Percentile 137747.61
( 95th Percentile - 5th Percentile ) 13212.93
Mean Distribution
Standard Deviation 44.6851
95.00% Confidence Interval ( 130924.82 - 131099.98 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3613
0.1 Scale Factor Error with Delta=300 137796
0.05 Scale Factor Error with Delta=300 551183
0.01 Scale Factor Error with Delta=300 13779573
DPS(e)
447+460 2p_2p Damage Per Second (Effective)
Count 8084
Mean 719851.86
Minimum 671874.19
Maximum 793306.96
Spread ( max - min ) 121432.77
Range [ ( max - min ) / 2 * 100% ] 8.43%
Damage
447+460 2p_2p Damage
Count 8084
Mean 215607333.30
Minimum 166537638.30
Maximum 269585182.72
Spread ( max - min ) 103047544.42
Range [ ( max - min ) / 2 * 100% ] 23.90%
DTPS
447+460 2p_2p Damage Taken Per Second
Count 8084
Mean 3725.00
Minimum 883.11
Maximum 8427.40
Spread ( max - min ) 7544.29
Range [ ( max - min ) / 2 * 100% ] 101.27%
HPS
447+460 2p_2p Healing Per Second
Count 8084
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+460 2p_2p Healing Per Second (Effective)
Count 8084
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+460 2p_2p Heal
Count 8084
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+460 2p_2p Healing Taken Per Second
Count 8084
Mean 3217.89
Minimum 617.30
Maximum 6674.21
Spread ( max - min ) 6056.91
Range [ ( max - min ) / 2 * 100% ] 94.11%
TMI
447+460 2p_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+460 2p_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+460 2p_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.09 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.32 starfall,if=variable.starfall_condition1
M 1.37 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.18 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.21 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.80 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQQRRLRLRLRLRKLQRQRRRRLRRLLRKLQRQRRRLRLRRLKLRLOOQRRRLRKLQRQRRLPRLOLORLQRRQRRRLRKLOFOQRQRERRLLRKLQROOQRRRLRLRQRROOLRLRLRRLPQRQRLLRRLOORLQRRQRRRLOORLRLQRRRLRLRKLFOOLMLNRERRLRLRKLPQRQRRLRRLKLQQRRRRLRLRRLQRQOORLRLRRKLRQRQRRRLRKLLOOQPRLRRLRKLQROOFQRRLRRKLEQRQRRRLRLOORLLRQRRRLDROKLOQRRLRLPRRKLQRLR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+460 2p_2p 0.0/100: 0% astral_power
Pre precombat 1 food 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+460 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+460 2p_2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.940 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.881 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.822 aoe J moonfire enemy3 65.2/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.762 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:04.701 aoe M starfire Fluffy_Pillow 34.2/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.515 aoe N incarnation_chosen_of_elune Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.515 default D potion Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage
0:05.515 default E use_items Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:05.515 aoe P fury_of_elune Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.336 aoe Q starfall Fluffy_Pillow 64.4/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.157 aoe Q starfall Fluffy_Pillow 39.4/100: 39% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.950 aoe R starfire Fluffy_Pillow 15.4/100: 15% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.704 aoe R starfire Fluffy_Pillow 76.6/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.458 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.220 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.364 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.128 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.269 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.031 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.176 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.941 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.084 aoe K cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.084 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.940 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.762 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.948 aoe Q starfall Fluffy_Pillow 40.8/100: 41% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.741 aoe R starfire Fluffy_Pillow 7.8/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.884 aoe R starfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.028 aoe R starfire Fluffy_Pillow 48.2/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.173 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.316 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.079 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.222 aoe R starfire Fluffy_Pillow 72.8/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos(11), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.364 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_urctos(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.127 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.889 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.032 aoe K cancel_buff Fluffy_Pillow 94.2/100: 94% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(7), undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.032 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), best_friends_with_urctos(7), undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.888 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, best_friends_with_urctos(6), undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.712 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(2), best_friends_with_urctos(5), undulating_sporecloak, elemental_potion_of_ultimate_power
0:33.899 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(2), best_friends_with_urctos(4), undulating_sporecloak, elemental_potion_of_ultimate_power
0:34.692 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), best_friends_with_urctos(3), undulating_sporecloak, elemental_potion_of_ultimate_power
0:35.837 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), best_friends_with_urctos(2), undulating_sporecloak
0:36.981 aoe R starfire Fluffy_Pillow 76.8/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos, undulating_sporecloak
0:38.123 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), undulating_sporecloak
0:38.885 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak
0:40.027 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), undulating_sporecloak
0:41.019 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), undulating_sporecloak
0:42.506 aoe R starfire Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), undulating_sporecloak
0:43.991 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), undulating_sporecloak
0:44.983 aoe K cancel_buff Fluffy_Pillow 64.6/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), undulating_sporecloak
0:44.983 aoe L starfall Fluffy_Pillow 64.6/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), undulating_sporecloak
0:46.093 aoe R starfire Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, undulating_sporecloak, corrupting_rage
0:47.692 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power primordial_arcanic_pulsar(40), starfall(3), starlord, dreamstate(2), undulating_sporecloak, corrupting_rage
0:48.866 aoe O wrath Fluffy_Pillow 34.6/100: 35% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
0:49.620 aoe O wrath Fluffy_Pillow 44.6/100: 45% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), undulating_sporecloak, corrupting_rage
0:50.374 aoe Q starfall Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), undulating_sporecloak, corrupting_rage
0:51.506 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:53.141 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
0:54.776 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:56.285 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:57.293 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.805 aoe K cancel_buff Fluffy_Pillow 77.4/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.805 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, undulating_sporecloak, wafting_devotion, corrupting_rage
0:59.932 aoe Q starfall Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, undulating_sporecloak, wafting_devotion, corrupting_rage
1:00.919 aoe R starfire Fluffy_Pillow 11.4/100: 11% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.344 aoe Q starfall Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:03.297 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:04.669 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:06.045 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:06.961 aoe P fury_of_elune Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:07.878 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.251 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:10.168 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
1:11.161 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage
1:12.251 aoe O wrath Fluffy_Pillow 34.2/100: 34% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:13.006 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
1:13.988 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), undulating_sporecloak, corrupting_rage
1:15.208 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:16.382 aoe R starfire Fluffy_Pillow 7.4/100: 7% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:18.075 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:19.767 aoe Q starfall Fluffy_Pillow 55.8/100: 56% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:20.898 aoe R starfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:22.532 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:24.167 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
1:25.801 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:26.810 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:28.321 aoe K cancel_buff Fluffy_Pillow 79.4/100: 79% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:28.321 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power primordial_arcanic_pulsar(45), starfall, dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:29.449 aoe O wrath Fluffy_Pillow 36.4/100: 36% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:30.205 default F natures_vigil 447+460 2p_2p 48.4/100: 48% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, dreamstate, best_friends_with_pip_static, wafting_devotion
1:30.205 aoe O wrath Fluffy_Pillow 48.4/100: 48% astral_power natures_vigil, primordial_arcanic_pulsar(50), starfall(2), starlord, best_friends_with_pip_static, wafting_devotion
1:30.960 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip_static, wafting_devotion
1:32.045 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, wafting_devotion
1:33.612 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion
1:34.658 aoe R starfire Fluffy_Pillow 9.6/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, wafting_devotion
1:36.032 default E use_items Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:36.032 aoe R starfire Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
1:37.406 aoe R starfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
1:38.780 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(90)
1:39.696 aoe L starfall Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(85)
1:40.613 aoe R starfire Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(80)
1:41.987 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(75)
1:41.987 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(75)
1:43.013 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
1:44.003 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
1:45.426 aoe O wrath Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
1:46.376 aoe O wrath Fluffy_Pillow 43.6/100: 44% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
1:47.131 aoe Q starfall Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
1:48.175 aoe R starfire Fluffy_Pillow 16.6/100: 17% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
1:49.083 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
1:50.594 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
1:52.228 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
1:53.237 aoe R starfire Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
1:54.748 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
1:55.756 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
1:57.267 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:58.396 aoe R starfire Fluffy_Pillow 7.6/100: 8% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:00.023 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:01.649 aoe O wrath Fluffy_Pillow 52.0/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:02.734 aoe O wrath Fluffy_Pillow 64.0/100: 64% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:03.487 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:04.573 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:05.515 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:06.561 aoe R starfire Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:08.197 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:09.287 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:10.924 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:12.559 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:13.783 aoe P fury_of_elune Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:14.851 aoe Q starfall Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:15.918 aoe R starfire Fluffy_Pillow 29.8/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:17.457 aoe Q starfall Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.484 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:19.971 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:20.963 aoe L starfall Fluffy_Pillow 44.2/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:21.954 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:23.438 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:24.924 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:26.014 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:26.769 aoe O wrath Fluffy_Pillow 53.4/100: 53% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:27.524 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:29.159 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:30.381 aoe Q starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:31.555 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.249 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:34.944 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:36.073 aoe R starfire Fluffy_Pillow 12.0/100: 12% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:37.707 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:39.344 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:40.979 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:42.070 aoe O wrath Fluffy_Pillow 34.6/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:43.161 aoe O wrath Fluffy_Pillow 46.6/100: 47% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:43.916 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
2:44.898 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:46.119 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:47.877 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:49.051 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:50.184 aoe R starfire Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:51.670 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:53.154 aoe R starfire Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:54.641 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:55.632 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:57.117 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:58.109 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:59.596 aoe K cancel_buff Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:59.596 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.705 default F natures_vigil 447+460 2p_2p 41.4/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.705 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:01.774 aoe O wrath Fluffy_Pillow 53.4/100: 53% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:02.529 aoe L starfall Fluffy_Pillow 65.4/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:03.705 aoe M starfire Fluffy_Pillow 24.4/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:04.724 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:05.857 aoe N incarnation_chosen_of_elune Fluffy_Pillow 36.6/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:05.857 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:06.749 default E use_items Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:06.749 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:07.641 aoe R starfire Fluffy_Pillow 81.0/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:09.126 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(90)
3:10.116 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(85)
3:11.601 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(80)
3:12.592 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(75)
3:14.078 aoe K cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(65)
3:14.078 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(65)
3:15.188 aoe P fury_of_elune Fluffy_Pillow 53.4/100: 53% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(60)
3:16.257 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(55)
3:17.325 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(50)
3:18.353 aoe Q starfall Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(45)
3:19.382 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(40)
3:20.869 aoe R starfire Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:22.354 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:23.345 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:24.832 aoe R starfire Fluffy_Pillow 81.2/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:26.319 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:27.311 aoe K cancel_buff Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:27.311 aoe L starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:28.421 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:29.488 aoe Q starfall Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:30.516 aoe R starfire Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:32.000 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:33.484 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:34.970 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:36.454 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:37.447 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:38.932 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:39.925 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:41.412 aoe R starfire Fluffy_Pillow 77.2/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static
3:42.897 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), best_friends_with_pip(10), best_friends_with_pip_static
3:44.008 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord, best_friends_with_pip(9), best_friends_with_pip_static
3:45.076 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
3:46.615 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
3:47.642 aoe O wrath Fluffy_Pillow 20.2/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
3:48.633 aoe O wrath Fluffy_Pillow 32.2/100: 32% astral_power primordial_arcanic_pulsar(40), starfall(3), starlord(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
3:49.388 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
3:50.372 aoe L starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak
3:51.461 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
3:53.096 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:54.186 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:55.821 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:57.456 aoe K cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:57.456 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:58.678 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:00.436 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:01.611 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:03.153 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:04.182 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:05.668 aoe R starfire Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:07.155 aoe R starfire Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.640 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:09.631 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:11.117 aoe K cancel_buff Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:11.117 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:12.228 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:13.296 aoe O wrath Fluffy_Pillow 48.2/100: 48% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:14.050 aoe O wrath Fluffy_Pillow 58.2/100: 58% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:14.803 aoe Q starfall Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:15.936 aoe P fury_of_elune Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:17.027 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:18.537 aoe L starfall Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:19.545 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:21.056 aoe R starfire Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:22.567 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:23.575 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.086 aoe K cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.086 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:26.216 aoe Q starfall Fluffy_Pillow 47.0/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:27.303 aoe R starfire Fluffy_Pillow 4.0/100: 4% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:28.870 aoe O wrath Fluffy_Pillow 23.2/100: 23% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:29.916 aoe O wrath Fluffy_Pillow 37.2/100: 37% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:30.670 default F natures_vigil 447+460 2p_2p 47.2/100: 47% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:30.705 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.750 aoe R starfire Fluffy_Pillow 6.2/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.657 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:34.292 aoe L starfall Fluffy_Pillow 58.6/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:35.382 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:37.016 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:38.652 aoe K cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:38.652 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:39.875 default E use_items Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:39.875 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
4:40.943 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(95)
4:42.485 aoe Q starfall Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(90)
4:43.514 aoe R starfire Fluffy_Pillow 16.2/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(85)
4:45.000 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
4:46.486 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
4:47.973 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall, starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
4:48.966 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
4:50.452 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
4:51.443 aoe O wrath Fluffy_Pillow 39.0/100: 39% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
4:52.195 aoe O wrath Fluffy_Pillow 53.0/100: 53% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
4:52.949 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
4:54.584 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
4:55.806 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
4:56.982 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
4:58.675 aoe Q starfall Fluffy_Pillow 69.4/100: 69% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
4:59.806 aoe R starfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
5:01.441 aoe R starfire Fluffy_Pillow 45.6/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:03.074 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:04.708 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:05.799 default D potion Fluffy_Pillow 47.0/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:05.799 aoe R starfire Fluffy_Pillow 47.0/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:07.435 aoe O wrath Fluffy_Pillow 68.2/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:08.526 aoe K cancel_buff Fluffy_Pillow 80.2/100: 80% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:08.526 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:09.747 aoe O wrath Fluffy_Pillow 39.2/100: 39% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:10.502 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:11.677 aoe R starfire Fluffy_Pillow 14.2/100: 14% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:12.693 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:14.387 aoe L starfall Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:15.518 aoe R starfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:17.152 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:18.244 aoe P fury_of_elune Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:19.235 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:20.722 aoe R starfire Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:22.207 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:22.207 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:23.318 aoe Q starfall Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:24.386 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:25.926 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:26.955 aoe R starfire Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 34766 33111 29401
Intellect 2089 0 13371 12565 9878 (5981)
Spirit 0 0 0 0 0
Health 695320 695320 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13371 12565 0
Crit 27.22% 21.01% 2881
Haste 23.23% 23.23% 3742
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 13906 13068 0
Mastery 27.66% 27.66% 7021
Armor 4406 4406 4406
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 466.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+460 2p_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=465.88
# gear_stamina=29401
# gear_intellect=9878
# gear_crit_rating=2881
# gear_haste_rating=3742
# gear_mastery_rating=7021
# gear_versatility_rating=747
# gear_armor=4406
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

447+470 2p_2p : 729643 dps, 132785 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
729643.4 729643.4 362.7 / 0.050% 64741.4 / 8.9% 53514.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.9 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+470 2p_2p 729643
Astral Smolder 100046 13.7% 374.8 0.86s 79963 0 Periodic 736.6 40685 0 40685 0.0% 81.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 374.78 0.00 736.58 736.58 287.34 0.0000 2.0000 29968411.06 29968411.06 0.00% 20342.89 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 736.58 549 935 40685.11 3380 212088 40746.20 35496 48119 29968411 29968411 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20446 2.8% 5.1 64.76s 1193581 1221108 Direct 757.2 5129 10884 8088 51.4%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 757.20 0.00 0.00 0.00 0.9775 0.0000 6123856.33 6123856.33 0.00% 1221107.94 1221107.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.58% 367.85 228 519 5129.03 2708 16362 5137.07 4495 6006 1886586 1886586 0.00%
crit 51.42% 389.35 263 576 10883.65 5416 32724 10888.30 9766 12423 4237271 4237271 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2987 0.4% 16.9 17.15s 53097 0 Direct 16.9 41508 83535 53095 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.89 16.89 0.00 0.00 0.00 0.0000 0.0000 896898.93 896898.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.44% 12.24 3 26 41508.13 27597 160192 41362.40 27816 90657 507941 507941 0.00%
crit 27.56% 4.66 0 14 83535.01 55195 320384 82702.07 0 317088 388958 388958 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2874 0.4% 33.8 8.70s 25486 0 Direct 33.7 20062 40101 25552 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.83 33.74 0.00 0.00 0.00 0.0000 0.0000 862131.50 862131.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.61% 24.50 10 46 20062.37 19533 22677 20061.92 19750 20920 491538 491538 0.00%
crit 27.39% 9.24 0 22 40101.31 39067 45353 40098.16 0 43225 370594 370594 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 73204 10.0% 3.0 1.09s 7318299 7855062 Direct 6.0 7298 14594 10844 48.6%
Periodic 1803.5 8549 17344 12137 40.8% 99.3%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1803.53 1803.53 0.00 0.9318 0.9901 21954897.17 21954897.17 0.00% 12275.36 7855061.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.42% 3.09 0 6 7298.19 7225 8244 7205.20 0 8244 22515 22515 0.00%
crit 48.58% 2.91 0 6 14593.93 14450 16489 14318.41 0 16489 42541 42541 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.20% 1067.68 788 1379 8548.63 6783 13776 8547.56 8288 8769 9127068 9127068 0.00%
crit 40.80% 735.85 522 944 17344.37 13566 27551 17345.45 16898 17915 12762773 12762773 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (66438) 0.0% (9.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 17933 2.5% 233.1 1.48s 23078 0 Direct 232.5 14859 31271 23138 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.05 232.45 0.00 0.00 0.00 0.0000 0.0000 5378439.20 5378439.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.56% 115.20 70 164 14858.97 10952 27013 14860.96 13905 15736 1711689 1711689 0.00%
crit 50.44% 117.26 74 171 31271.35 21904 54027 31287.76 29521 33662 3666750 3666750 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 18032 2.5% 234.8 1.48s 23030 0 Direct 234.2 14821 31191 23089 50.5%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.81 234.21 0.00 0.00 0.00 0.0000 0.0000 5407569.32 5407569.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.49% 115.91 70 175 14821.10 10149 27013 14822.41 13830 15824 1717965 1717965 0.00%
crit 50.51% 118.29 73 167 31191.19 20298 54027 31207.12 29321 33569 3689604 3689604 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 30473 4.2% 15.6 19.38s 585990 0 Direct 93.3 62954 132589 97956 50.3%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.60 93.30 0.00 0.00 0.00 0.0000 0.0000 9139168.40 9139168.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.73% 46.40 22 78 62954.27 34865 223960 62979.54 48410 77470 2920970 2920970 0.00%
crit 50.27% 46.90 22 76 132589.16 69730 454616 132614.86 100056 163795 6218199 6218199 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 227356 31.2% 103.7 2.87s 657006 642246 Direct 1770.2 25744 54622 38494 44.2%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.71 1770.18 0.00 0.00 0.00 1.0230 0.0000 68139060.27 68139060.27 0.00% 642245.73 642245.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.85% 988.63 713 1281 25744.33 6321 92014 25788.31 23845 28274 25450556 25450556 0.00%
crit 44.15% 781.56 579 1016 54622.29 12642 184027 54698.22 50520 60194 42688505 42688505 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.53
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.18
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 165012 22.6% 116.8 2.53s 423326 300255 Direct 707.0 44266 94087 69955 51.6%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.83 706.98 0.00 0.00 0.00 1.4099 0.0000 49457179.71 49457179.71 0.00% 300255.47 300255.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.44% 342.44 232 452 44266.37 6337 199853 44277.75 39378 51290 15158836 15158836 0.00%
crit 51.56% 364.54 261 476 94087.21 12675 405771 94119.99 83182 109579 34298343 34298343 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.37
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:116.01
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 62262 8.5% 1.0 0.00s 18662462 19874826 Direct 1.0 5746 11489 7322 27.5%
Periodic 1816.4 7329 15280 10270 37.0% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1816.43 1816.43 0.00 0.9395 0.9898 18662461.63 18662461.63 0.00% 10374.98 19874826.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.51% 0.73 0 1 5745.75 5712 5779 4166.04 0 5779 4166 4166 0.00%
crit 27.49% 0.27 0 1 11488.84 11423 11557 3158.67 0 11557 3159 3159 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.00% 1144.44 840 1442 7328.73 5606 12523 7330.44 7127 7568 8387194 8387194 0.00%
crit 37.00% 671.99 488 865 15280.28 11212 25047 15285.79 14831 15835 10267943 10267943 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5482) 0.0% (0.8%) 8.3 32.41s 197829 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2864 0.4% 8.3 32.41s 103327 0 Direct 49.9 13509 26996 17221 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 49.89 0.00 0.00 0.00 0.0000 0.0000 859104.09 859104.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.48% 36.16 6 86 13509.31 13150 15266 13508.55 13173 14694 488458 488458 0.00%
crit 27.52% 13.73 1 41 26995.88 26300 30532 26998.10 26391 29274 370646 370646 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2619 0.4% 16.0 15.81s 49175 0 Direct 95.9 6428 12848 8196 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.98 95.87 0.00 0.00 0.00 0.0000 0.0000 785734.18 785734.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.47% 69.47 13 165 6428.31 6257 7264 6428.16 6285 6839 446604 446604 0.00%
crit 27.53% 26.40 2 77 12847.99 12514 14528 12849.25 12569 13774 339130 339130 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3537 0.5% 26.1 10.48s 40823 52759 Direct 26.0 29437 58833 41049 39.5%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.13 25.99 0.00 0.00 0.00 0.7738 0.0000 1066842.01 1066842.01 0.00% 52759.11 52759.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.49% 15.72 5 27 29436.60 12967 54003 29383.75 21371 37027 462760 462760 0.00%
crit 39.51% 10.27 1 21 58832.84 25935 110367 58722.94 25935 79677 604082 604082 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.21
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+470 2p_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 55.71s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.44s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 306.63s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.45
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.6 5.5 17.6s 13.6s 9.5s 55.74% 57.58% 5.5 (18.2) 17.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:51.50% / 59.32%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.78%
  • balance_of_all_things_arcane_2:6.18%
  • balance_of_all_things_arcane_3:6.64%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.51%
  • balance_of_all_things_arcane_7:7.62%
  • balance_of_all_things_arcane_8:7.68%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.0s 30.0s 7.9s 26.91% 29.96% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.6s
  • trigger_min/max:5.2s / 47.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.46% / 29.97%

Stack Uptimes

  • balance_of_all_things_nature_1:3.33%
  • balance_of_all_things_nature_2:3.34%
  • balance_of_all_things_nature_3:3.35%
  • balance_of_all_things_nature_4:3.36%
  • balance_of_all_things_nature_5:3.37%
  • balance_of_all_things_nature_6:3.38%
  • balance_of_all_things_nature_7:3.39%
  • balance_of_all_things_nature_8:3.40%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 69.4s 69.4s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 340.8s
  • trigger_min/max:12.0s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 49.38%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.7s 69.4s 45.1s 33.30% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.2s
  • trigger_min/max:12.0s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 311.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.30%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.2s 69.2s 10.8s 10.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 323.9s
  • trigger_min/max:12.0s / 323.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.94%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.94%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.7s 69.2s 44.8s 33.21% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.9s / 353.2s
  • trigger_min/max:12.0s / 323.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 285.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.21%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.8s 69.8s 10.8s 10.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 317.3s
  • trigger_min/max:12.0s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.14%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.93%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.94%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.0s 69.8s 45.1s 33.49% 0.00% 70.3 (70.3) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 347.2s
  • trigger_min/max:12.0s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 321.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.49%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.7s 50.3s 80.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 310.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.1s
  • uptime_min/max:43.46% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.23%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.2 20.6s 21.4s 2.2s 10.87% 20.51% 0.2 (0.3) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.5s
  • uptime_min/max:7.25% / 15.60%

Stack Uptimes

  • dreamstate_1:7.32%
  • dreamstate_2:3.55%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.0 23.9s 15.0s 21.2s 93.03% 93.71% 8.0 (8.0) 12.3

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 70.8s
  • trigger_min/max:0.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.15% / 96.26%

Stack Uptimes

  • eclipse_lunar_1:93.03%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.4s 38.4s 19.1s 52.29% 54.22% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.69% / 59.71%

Stack Uptimes

  • eclipse_solar_1:52.29%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.0s 306.0s 27.3s 12.95% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.75% / 17.84%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.95%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.8s 64.8s 7.9s 13.51% 0.00% 75.9 (75.9) 5.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.5s
  • trigger_min/max:60.0s / 88.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.70% / 15.61%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.4s 38.4s 19.1s 52.29% 54.93% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.69% / 59.71%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.29%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 119.6s
  • trigger_min/max:90.0s / 119.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.35% / 26.97%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.21%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.49% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.8s 69.1s 0.9s 0.75% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 342.5s
  • trigger_min/max:0.0s / 342.5s
  • trigger_pct:14.96%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.00% / 5.99%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.5 34.4s 34.4s 30.2s 91.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.6s / 46.7s
  • trigger_min/max:21.6s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s
  • uptime_min/max:87.85% / 94.59%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.19%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.68%
  • primordial_arcanic_pulsar_20:8.31%
  • primordial_arcanic_pulsar_25:8.51%
  • primordial_arcanic_pulsar_30:8.20%
  • primordial_arcanic_pulsar_35:8.68%
  • primordial_arcanic_pulsar_40:9.10%
  • primordial_arcanic_pulsar_45:9.04%
  • primordial_arcanic_pulsar_50:8.91%
  • primordial_arcanic_pulsar_55:8.92%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.3 15.6s 13.6s 6.6s 43.78% 42.98% 3.3 (3.3) 19.4

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.2s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.90% / 46.92%

Stack Uptimes

  • solstice_1:43.78%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.7 0.0 143.3s 2.9s 296.1s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.0s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:23.1s / 358.0s
  • uptime_min/max:98.30% / 99.49%

Stack Uptimes

  • starfall_1:5.55%
  • starfall_2:33.55%
  • starfall_3:41.97%
  • starfall_4:14.41%
  • starfall_5:3.06%
  • starfall_6:0.33%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.7 14.5s 2.9s 13.9s 97.51% 0.00% 41.3 (41.3) 5.9

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.5s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.96% / 99.33%

Stack Uptimes

  • starlord_1:12.81%
  • starlord_2:17.92%
  • starlord_3:66.79%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.9s 11.5s 1.6s 12.31% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 54.6s
  • trigger_min/max:0.0s / 54.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.05% / 23.94%

Stack Uptimes

  • umbral_embrace_1:12.31%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.8s 5.5s 43.2s 90.18% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 315.0s
  • trigger_min/max:5.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.0s
  • uptime_min/max:68.69% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.4s 45.9s 16.5s 23.40% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 208.8s
  • trigger_min/max:0.0s / 208.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.1s
  • uptime_min/max:4.67% / 55.47%

Stack Uptimes

  • wafting_devotion_1:23.40%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.6s 22.6s 47.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.68% 0.0s 0.0s 1.1s
Astral Smolder 73.94% 63.09% 82.97% 4.2s 0.0s 48.6s
Incarnation (Total) 52.29% 46.69% 59.71% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.03% 29.23% 34.83% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.73% 33.31% 47.28% 9.5s 0.0s 15.0s
No Eclipse 6.94% 3.74% 9.85% 1.7s 0.0s 5.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.9990.00028.51025.6475.79475.214

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.13100.0%0.000.0%0.000.0%0.000.0%
Starfire2.422.1%0.000.0%49.9542.4%65.4655.6%
Starfall21.197.2%0.000.0%119.0540.2%156.0852.7%
Fury of Elune20.942.8%0.000.0%142.5418.8%593.7178.4%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+470 2p_2p
Fury of EluneAstral Power80.87242.055.85%2.990.550.23%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.60465.9311.25%29.871.970.42%
Shooting Stars (Moonfire)Astral Power233.06465.8711.25%2.000.260.05%
Shooting Stars (Sunfire)Astral Power234.81469.3711.34%2.000.250.05%
StarfireAstral Power117.832211.5653.42%18.7733.351.49%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.13261.336.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+470 2p_2p
StarfallAstral Power 104.124102.87100.00%39.4139.5616607.64
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 710400.0 3263.22 3776.98 2656277.2 556184.6 -2420.7 710400.0
Astral Power 20.0 13.79 13.61 36.4 53.3 0.2 100.0

Statistics & Data Analysis

Fight Length
447+470 2p_2p Fight Length
Count 8151
Mean 300.17
Minimum 240.00
Maximum 359.95
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.6124
5th Percentile 246.29
95th Percentile 354.30
( 95th Percentile - 5th Percentile ) 108.01
Mean Distribution
Standard Deviation 0.3834
95.00% Confidence Interval ( 299.42 - 300.92 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 511
0.1% Error 51077
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1023
DPS
447+470 2p_2p Damage Per Second
Count 8151
Mean 729643.44
Minimum 675817.09
Maximum 804144.44
Spread ( max - min ) 128327.35
Range [ ( max - min ) / 2 * 100% ] 8.79%
Standard Deviation 16708.5281
5th Percentile 703308.50
95th Percentile 758490.48
( 95th Percentile - 5th Percentile ) 55181.98
Mean Distribution
Standard Deviation 185.0686
95.00% Confidence Interval ( 729280.71 - 730006.16 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2015
0.1 Scale Factor Error with Delta=300 2383198
0.05 Scale Factor Error with Delta=300 9532791
0.01 Scale Factor Error with Delta=300 238319762
Priority Target DPS
447+470 2p_2p Priority Target Damage Per Second
Count 8151
Mean 132784.77
Minimum 119298.50
Maximum 147934.31
Spread ( max - min ) 28635.81
Range [ ( max - min ) / 2 * 100% ] 10.78%
Standard Deviation 4039.1133
5th Percentile 126358.16
95th Percentile 139719.81
( 95th Percentile - 5th Percentile ) 13361.65
Mean Distribution
Standard Deviation 44.7384
95.00% Confidence Interval ( 132697.08 - 132872.45 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3555
0.1 Scale Factor Error with Delta=300 139270
0.05 Scale Factor Error with Delta=300 557078
0.01 Scale Factor Error with Delta=300 13926942
DPS(e)
447+470 2p_2p Damage Per Second (Effective)
Count 8151
Mean 729643.44
Minimum 675817.09
Maximum 804144.44
Spread ( max - min ) 128327.35
Range [ ( max - min ) / 2 * 100% ] 8.79%
Damage
447+470 2p_2p Damage
Count 8151
Mean 218701753.81
Minimum 170660052.79
Maximum 270021677.69
Spread ( max - min ) 99361624.90
Range [ ( max - min ) / 2 * 100% ] 22.72%
DTPS
447+470 2p_2p Damage Taken Per Second
Count 8151
Mean 3778.27
Minimum 861.48
Maximum 7341.93
Spread ( max - min ) 6480.45
Range [ ( max - min ) / 2 * 100% ] 85.76%
HPS
447+470 2p_2p Healing Per Second
Count 8151
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+470 2p_2p Healing Per Second (Effective)
Count 8151
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+470 2p_2p Heal
Count 8151
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+470 2p_2p Healing Taken Per Second
Count 8151
Mean 3257.36
Minimum 652.26
Maximum 7066.60
Spread ( max - min ) 6414.34
Range [ ( max - min ) / 2 * 100% ] 98.46%
TMI
447+470 2p_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+470 2p_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+470 2p_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.45 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.12 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.53 starfall,if=variable.starfall_condition1
M 1.37 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.21 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.18 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 116.01 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQLRLRLRLRLRRKLQRQRRRLRLRLRLRKLQRQRRRLLRRLRKLQROOQRRRLLRRLQQRRPOOLRLRKLLRRLRRLOORKLRFQRQRELRRLRKLOOLRQRLRRLRQOOQRRQRRLPRKLQQRRLRLOORLKLQRRQRRRLOORKLRQRLRRLRLRKLOOQRQFRRRLNERKLQPQRRRLRLRKLLQRRLRRLRLRQQRRQRRRLLOOKLQRRQRRLROLORRLLRQRRRLROLORQRQRRLPFRLRLREKLLQROOLRRLRKLRQRROOLRLRKLQRQRDRRLROLORLRLQRRRPLROKLORL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+470 2p_2p 0.0/100: 0% astral_power
Pre precombat 1 food 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+470 2p_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+470 2p_2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.939 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.880 aoe J moonfire enemy2 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.821 aoe J moonfire enemy5 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.760 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:04.698 aoe M starfire Fluffy_Pillow 38.2/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.511 aoe N incarnation_chosen_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.511 default D potion Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage
0:05.511 default E use_items Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:05.511 aoe P fury_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.332 aoe Q starfall Fluffy_Pillow 68.4/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.152 aoe L starfall Fluffy_Pillow 43.4/100: 43% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.944 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.698 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.462 aoe R starfire Fluffy_Pillow 52.6/100: 53% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.216 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.980 aoe R starfire Fluffy_Pillow 55.8/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.123 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.888 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.032 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.796 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), umbral_embrace, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.853 aoe R starfire Fluffy_Pillow 71.4/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.910 aoe K cancel_buff Fluffy_Pillow 94.6/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.910 aoe L starfall Fluffy_Pillow 94.6/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.699 aoe Q starfall Fluffy_Pillow 61.6/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.461 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.558 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.314 aoe R starfire Fluffy_Pillow 14.8/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.068 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.127 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.183 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.937 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.995 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.750 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.807 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.563 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.620 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.374 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.432 aoe K cancel_buff Fluffy_Pillow 94.4/100: 94% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.432 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.286 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.108 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.293 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.084 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.226 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:36.367 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:37.510 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:38.273 aoe L starfall Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:39.037 aoe R starfire Fluffy_Pillow 14.2/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:40.180 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:41.665 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
0:42.657 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:44.141 aoe K cancel_buff Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:44.141 aoe L starfall Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), undulating_sporecloak, corrupting_rage
0:45.252 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, undulating_sporecloak, corrupting_rage
0:46.318 aoe R starfire Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(2), undulating_sporecloak, corrupting_rage
0:47.856 aoe O wrath Fluffy_Pillow 28.8/100: 29% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), dreamstate, undulating_sporecloak, wafting_devotion, corrupting_rage
0:48.610 aoe O wrath Fluffy_Pillow 40.8/100: 41% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage
0:49.366 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage
0:50.412 aoe R starfire Fluffy_Pillow 13.8/100: 14% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), umbral_embrace, undulating_sporecloak, wafting_devotion, corrupting_rage
0:51.921 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:53.430 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:54.941 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:55.949 aoe L starfall Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:56.864 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.236 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:59.609 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:00.634 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord, undulating_sporecloak, wafting_devotion, corrupting_rage
1:01.620 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.570 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage
1:04.054 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
1:05.539 aoe P fury_of_elune Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
1:06.529 aoe O wrath Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
1:07.519 aoe O wrath Fluffy_Pillow 68.4/100: 68% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:08.273 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:09.364 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:10.344 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), undulating_sporecloak, corrupting_rage
1:11.433 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:13.067 aoe K cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:13.067 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), undulating_sporecloak, corrupting_rage
1:14.287 aoe L starfall Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, undulating_sporecloak, corrupting_rage
1:15.461 aoe R starfire Fluffy_Pillow 7.8/100: 8% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), undulating_sporecloak, corrupting_rage
1:17.152 aoe R starfire Fluffy_Pillow 27.0/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), undulating_sporecloak, corrupting_rage
1:18.846 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
1:19.975 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:21.606 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:23.238 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:24.327 aoe O wrath Fluffy_Pillow 33.4/100: 33% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:25.082 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:25.837 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:27.471 aoe K cancel_buff Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:27.471 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:28.689 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.449 default F natures_vigil 447+470 2p_2p 68.8/100: 69% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.449 aoe Q starfall Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:31.622 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:33.161 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:34.189 aoe R starfire Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:35.675 default E use_items Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:35.675 aoe L starfall Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:36.665 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:38.150 aoe R starfire Fluffy_Pillow 73.4/100: 73% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:39.636 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:40.626 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:42.110 aoe K cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:42.110 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:43.220 aoe O wrath Fluffy_Pillow 53.8/100: 54% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:43.974 aoe O wrath Fluffy_Pillow 65.8/100: 66% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:44.727 aoe L starfall Fluffy_Pillow 77.8/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
1:45.899 aoe R starfire Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:47.592 aoe Q starfall Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
1:48.721 aoe R starfire Fluffy_Pillow 31.0/100: 31% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
1:50.353 aoe L starfall Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
1:51.441 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
1:53.074 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
1:54.705 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
1:55.793 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:57.426 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:58.645 aoe O wrath Fluffy_Pillow 20.8/100: 21% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:59.818 aoe O wrath Fluffy_Pillow 34.8/100: 35% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:00.573 aoe Q starfall Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:01.658 aoe R starfire Fluffy_Pillow 5.8/100: 6% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:02.597 aoe R starfire Fluffy_Pillow 31.0/100: 31% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:04.162 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:05.208 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:06.715 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:08.223 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:09.231 aoe P fury_of_elune Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:10.146 aoe R starfire Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:11.516 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:11.516 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:12.542 aoe Q starfall Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:13.528 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:14.478 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:15.851 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:17.333 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.324 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:19.808 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:20.797 aoe O wrath Fluffy_Pillow 44.6/100: 45% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:21.552 aoe O wrath Fluffy_Pillow 56.6/100: 57% astral_power primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:22.306 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:23.816 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:24.823 aoe K cancel_buff Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:24.823 aoe L starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:25.949 aoe Q starfall Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:27.035 aoe R starfire Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(4), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:28.601 aoe R starfire Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:30.167 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:31.212 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:32.719 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:34.228 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:35.737 aoe L starfall Fluffy_Pillow 75.8/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:36.745 aoe O wrath Fluffy_Pillow 32.8/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:37.835 aoe O wrath Fluffy_Pillow 42.8/100: 43% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:38.591 aoe R starfire Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:39.571 aoe K cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:39.571 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_pip_static, undulating_sporecloak
2:40.791 aoe R starfire Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak
2:42.550 aoe Q starfall Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak
2:43.721 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak
2:45.260 aoe L starfall Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:46.289 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:47.772 aoe R starfire Fluffy_Pillow 74.6/100: 75% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:49.258 aoe L starfall Fluffy_Pillow 97.8/100: 98% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:50.248 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:51.733 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:52.724 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:54.209 aoe K cancel_buff Fluffy_Pillow 76.2/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:54.209 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:55.318 aoe O wrath Fluffy_Pillow 41.2/100: 41% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:56.073 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:56.827 aoe Q starfall Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:57.999 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:59.692 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.821 default F natures_vigil 447+470 2p_2p 6.4/100: 6% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:00.821 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:02.452 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
3:04.085 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
3:05.716 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
3:06.806 aoe N incarnation_chosen_of_elune Fluffy_Pillow 35.0/100: 35% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
3:06.806 default E use_items Fluffy_Pillow 35.0/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
3:06.806 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:07.700 aoe K cancel_buff Fluffy_Pillow 56.2/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:07.700 aoe L starfall Fluffy_Pillow 56.2/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:08.811 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(90)
3:09.876 aoe P fury_of_elune Fluffy_Pillow 26.2/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(85)
3:10.905 aoe Q starfall Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(80)
3:11.931 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(4), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(75)
3:12.824 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(70)
3:14.307 aoe R starfire Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(65)
3:15.791 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:16.782 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:18.267 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:19.257 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:20.740 aoe K cancel_buff Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:20.740 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:21.850 aoe L starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:22.916 aoe Q starfall Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:23.943 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:25.429 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:26.912 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:27.903 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:29.388 aoe R starfire Fluffy_Pillow 75.8/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:30.873 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:31.863 aoe R starfire Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:33.350 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:34.341 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:35.827 aoe Q starfall Fluffy_Pillow 79.4/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:36.937 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:38.004 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:39.543 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:41.082 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:42.111 aoe R starfire Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:43.596 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:45.080 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:46.563 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:47.554 aoe L starfall Fluffy_Pillow 55.4/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:48.547 aoe O wrath Fluffy_Pillow 22.4/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:49.537 aoe O wrath Fluffy_Pillow 64.4/100: 64% astral_power primordial_arcanic_pulsar(55), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:50.290 aoe K cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:50.290 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:51.511 aoe Q starfall Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:52.579 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.503 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.041 aoe Q starfall Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.068 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:57.555 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:59.038 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:00.029 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:01.514 aoe O wrath Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.432 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.438 aoe O wrath Fluffy_Pillow 31.4/100: 31% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:04.195 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:05.102 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:06.609 aoe L starfall Fluffy_Pillow 87.8/100: 88% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:07.735 aoe L starfall Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:08.820 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:10.384 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:11.429 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:12.939 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:14.448 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:15.954 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:16.963 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:18.471 aoe O wrath Fluffy_Pillow 67.8/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:19.480 aoe L starfall Fluffy_Pillow 77.8/100: 78% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:20.488 aoe O wrath Fluffy_Pillow 34.8/100: 35% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:21.245 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:22.151 aoe Q starfall Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:23.279 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:24.903 aoe Q starfall Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:25.987 aoe R starfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:27.552 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:29.117 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:30.162 aoe P fury_of_elune Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:31.078 default F natures_vigil 447+470 2p_2p 63.6/100: 64% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:31.078 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:32.450 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:33.367 aoe R starfire Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:34.740 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:35.657 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.030 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.030 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
4:37.030 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
4:38.056 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
4:39.042 aoe Q starfall Fluffy_Pillow 47.0/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
4:39.992 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
4:41.475 aoe O wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
4:42.230 aoe O wrath Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
4:42.984 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
4:44.073 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
4:45.707 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
4:47.340 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
4:48.431 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
4:50.063 aoe K cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
4:50.063 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
4:51.283 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
4:53.041 aoe Q starfall Fluffy_Pillow 61.8/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
4:54.214 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
4:55.907 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
4:57.599 aoe O wrath Fluffy_Pillow 61.2/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:58.731 aoe O wrath Fluffy_Pillow 71.2/100: 71% astral_power primordial_arcanic_pulsar(45), starfall, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
4:59.486 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
5:00.616 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
5:01.597 aoe L starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
5:02.684 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak
5:04.315 aoe K cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
5:04.315 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak
5:05.536 aoe Q starfall Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak
5:06.602 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
5:08.141 aoe Q starfall Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
5:09.171 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
5:10.656 default D potion Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
5:10.656 aoe R starfire Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:12.141 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:13.626 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:14.616 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:16.100 aoe O wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:17.091 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power primordial_arcanic_pulsar(15), starfall, starlord(3), dreamstate(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:18.180 aoe O wrath Fluffy_Pillow 32.6/100: 33% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:18.934 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:19.913 aoe L starfall Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:21.132 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:22.888 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:24.062 aoe Q starfall Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:25.192 aoe R starfire Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:26.824 aoe R starfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:28.457 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:30.088 aoe P fury_of_elune Fluffy_Pillow 67.6/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:31.253 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:32.343 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:33.977 aoe O wrath Fluffy_Pillow 61.6/100: 62% astral_power fury_of_elune, primordial_arcanic_pulsar(40), starfall, starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:34.731 aoe K cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power fury_of_elune, primordial_arcanic_pulsar(40), starfall, starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:34.731 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power fury_of_elune, primordial_arcanic_pulsar(40), starfall, umbral_embrace, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:35.951 aoe O wrath Fluffy_Pillow 40.6/100: 41% astral_power fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:36.705 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:38.461 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35520 33829 30119
Intellect 2089 0 13525 12712 10018 (6121)
Spirit 0 0 0 0 0
Health 710400 710400 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13525 12712 0
Crit 27.36% 21.15% 2907
Haste 23.39% 23.39% 3768
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 14066 13220 0
Mastery 27.74% 27.74% 7045
Armor 4506 4506 4506
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 467.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+470 2p_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.13
# gear_stamina=30119
# gear_intellect=10018
# gear_crit_rating=2907
# gear_haste_rating=3768
# gear_mastery_rating=7045
# gear_versatility_rating=747
# gear_armor=4506
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

460 T31_2p : 707726 dps, 129168 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
707726.2 707726.2 352.7 / 0.050% 63942.8 / 9.0% 51832.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.9 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31_2p 707726
Astral Smolder 100849 14.2% 373.4 0.86s 80699 0 Periodic 734.2 41046 0 41046 0.0% 81.7%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 373.45 0.00 734.23 734.23 285.97 0.0000 2.0000 30136659.49 30136659.49 0.00% 20522.60 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.23 552 937 41046.37 3412 241318 41103.13 35300 48378 30136659 30136659 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20648 2.9% 5.1 64.79s 1204378 1233168 Direct 756.4 5175 10974 8156 51.4%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 756.43 0.00 0.00 0.00 0.9767 0.0000 6169538.56 6169538.56 0.00% 1233167.81 1233167.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.58% 367.51 213 513 5174.81 2735 16482 5182.97 4560 6019 1901741 1901741 0.00%
crit 51.42% 388.92 264 563 10973.68 5471 32963 10980.44 9826 12466 4267798 4267798 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3002 0.4% 16.9 17.08s 53300 0 Direct 16.9 41830 83736 53299 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.87 16.87 0.00 0.00 0.00 0.0000 0.0000 899229.89 899229.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.62% 12.25 1 31 41830.24 27654 160477 41643.95 27895 99355 512476 512476 0.00%
crit 27.38% 4.62 0 14 83735.55 55309 320954 82919.28 0 320954 386754 386754 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2882 0.4% 33.8 8.72s 25522 0 Direct 33.7 20103 40168 25590 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.78 33.70 0.00 0.00 0.00 0.0000 0.0000 862259.84 862259.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 24.48 10 44 20103.16 19574 22717 20102.19 19786 21013 492153 492153 0.00%
crit 27.34% 9.21 1 24 40168.18 39147 45434 40170.91 39317 43112 370107 370107 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 61572 8.7% 3.0 1.08s 6140369 6597818 Direct 6.0 6137 12268 9105 48.4%
Periodic 1801.5 7188 14581 10195 40.7% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1801.55 1801.55 0.00 0.9308 0.9888 18421106.68 18421106.68 0.00% 10324.56 6597817.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.58% 3.09 0 6 6137.11 6078 6934 6050.90 0 6934 18992 18992 0.00%
crit 48.42% 2.91 0 6 12268.15 12156 13867 12043.66 0 13867 35641 35641 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.33% 1068.77 805 1366 7187.65 5707 11559 7186.90 6991 7384 7681859 7681859 0.00%
crit 40.67% 732.78 531 958 14581.29 11414 23118 14582.09 14150 15030 10684614 10684614 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (61033) 0.0% (8.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 15104 2.1% 232.8 1.48s 19404 0 Direct 232.2 12500 26299 19455 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 232.83 232.24 0.00 0.00 0.00 0.0000 0.0000 4518020.29 4518020.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.60% 115.19 73 176 12499.58 9218 22676 12501.70 11779 13508 1439817 1439817 0.00%
crit 50.40% 117.05 67 173 26298.70 18436 45352 26312.59 24860 28192 3078203 3078203 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 15176 2.1% 234.7 1.48s 19340 0 Direct 234.1 12468 26223 19390 50.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.70 234.11 0.00 0.00 0.00 0.0000 0.0000 4539193.97 4539193.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.68% 116.30 73 168 12467.71 8541 22676 12469.13 11774 13264 1449937 1449937 0.00%
crit 50.32% 117.81 75 176 26223.26 17082 45352 26236.79 24886 28516 3089257 3089257 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 30752 4.3% 15.6 19.42s 590478 0 Direct 93.2 63596 133654 98706 50.1%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.58 93.20 0.00 0.00 0.00 0.0000 0.0000 9199232.39 9199232.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.89% 46.49 21 77 63596.35 35209 228974 63624.97 49779 78351 2956555 2956555 0.00%
crit 50.11% 46.71 24 74 133653.88 70418 457949 133680.49 102705 164369 6242678 6242678 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy3
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 229702 32.5% 103.6 2.87s 662631 648609 Direct 1765.9 26033 55223 38887 44.0%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.63 1765.91 0.00 0.00 0.00 1.0216 0.0000 68668875.63 68668875.63 0.00% 648608.93 648608.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.96% 988.29 712 1272 26033.07 6384 92730 26082.36 23884 28630 25727173 25727173 0.00%
crit 44.04% 777.62 577 1013 55223.17 12767 185461 55306.53 50713 60649 42941703 42941703 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.55
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.09
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 166610 23.5% 116.7 2.53s 426933 303250 Direct 706.1 44700 94941 70552 51.5%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.68 706.10 0.00 0.00 0.00 1.4079 0.0000 49816023.07 49816023.07 0.00% 303249.59 303249.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.55% 342.78 237 450 44699.85 6398 201288 44709.60 39351 52227 15321945 15321945 0.00%
crit 51.45% 363.32 268 479 94941.29 12797 406379 94973.17 83984 108761 34494078 34494078 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.35
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.87
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 52372 7.4% 1.0 0.00s 15658980 16694008 Direct 1.0 4833 9663 6154 27.3%
Periodic 1814.5 6163 12847 8627 36.9% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1814.50 1814.50 0.00 0.9385 0.9884 15658979.96 15658979.96 0.00% 8726.32 16694008.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.71% 0.73 0 1 4832.89 4805 4861 3514.04 0 4861 3514 3514 0.00%
crit 27.29% 0.27 0 1 9663.39 9610 9722 2637.01 0 9722 2637 2637 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.14% 1145.68 860 1440 6162.83 4717 10508 6164.41 5985 6386 7060494 7060494 0.00%
crit 36.86% 668.83 505 866 12847.09 9433 21016 12851.98 12452 13373 8592335 8592335 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5493) 0.0% (0.8%) 8.3 32.79s 197912 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2868 0.4% 8.3 32.79s 103332 0 Direct 49.9 13538 27052 17222 27.3%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 49.87 0.00 0.00 0.00 0.0000 0.0000 858947.34 858947.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.74% 36.28 7 97 13537.76 13177 15293 13537.92 13177 14738 491129 491129 0.00%
crit 27.26% 13.60 0 40 27052.40 26354 30586 27054.26 0 29957 367818 367818 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2625 0.4% 16.0 15.93s 49202 0 Direct 95.9 6441 12873 8200 27.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.98 95.87 0.00 0.00 0.00 0.0000 0.0000 786189.41 786189.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.65% 69.65 14 173 6440.92 6270 7277 6441.06 6299 6915 448604 448604 0.00%
crit 27.35% 26.22 2 68 12872.92 12540 14554 12874.91 12613 13937 337585 337585 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3564 0.5% 26.1 10.47s 41066 53087 Direct 26.0 29695 59386 41297 39.1%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.11 25.97 0.00 0.00 0.00 0.7736 0.0000 1072348.53 1072348.53 0.00% 53086.56 53086.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.91% 15.82 5 29 29695.19 13091 54741 29642.57 19981 37249 469677 469677 0.00%
crit 39.09% 10.15 1 23 59385.60 26182 110563 59262.24 32560 78975 602671 602671 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.19
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 27.29s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.40s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 305.70s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.5 5.6 17.6s 13.5s 9.5s 55.76% 57.61% 5.6 (18.5) 16.9

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.5s
  • uptime_min/max:50.33% / 59.21%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.78%
  • balance_of_all_things_arcane_2:6.17%
  • balance_of_all_things_arcane_3:6.63%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.31%
  • balance_of_all_things_arcane_6:7.52%
  • balance_of_all_things_arcane_7:7.63%
  • balance_of_all_things_arcane_8:7.69%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.0s 30.0s 7.9s 26.96% 30.02% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.9s
  • trigger_min/max:5.0s / 47.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.47% / 29.98%

Stack Uptimes

  • balance_of_all_things_nature_1:3.33%
  • balance_of_all_things_nature_2:3.35%
  • balance_of_all_things_nature_3:3.36%
  • balance_of_all_things_nature_4:3.37%
  • balance_of_all_things_nature_5:3.38%
  • balance_of_all_things_nature_6:3.38%
  • balance_of_all_things_nature_7:3.39%
  • balance_of_all_things_nature_8:3.40%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 69.6s 69.6s 10.8s 10.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 348.9s
  • trigger_min/max:12.0s / 348.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.89%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.93%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 112.9s 69.6s 45.4s 33.50% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 355.8s
  • trigger_min/max:12.0s / 348.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.2s
  • uptime_min/max:0.00% / 95.83%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.50%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.8s 69.8s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 335.5s
  • trigger_min/max:12.0s / 335.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 36.33%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.7s 69.8s 45.0s 33.39% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.4s / 351.0s
  • trigger_min/max:12.0s / 335.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 301.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.39%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.2s 69.2s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 332.6s
  • trigger_min/max:12.0s / 332.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 42.68%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 69.2s 45.4s 33.12% 0.00% 68.7 (68.7) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 353.6s
  • trigger_min/max:12.0s / 332.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 310.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.12%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.6s 58.0s 49.8s 80.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 350.0s
  • trigger_min/max:15.0s / 303.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.8s
  • uptime_min/max:47.67% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.06%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.1 20.5s 21.4s 2.2s 10.90% 20.53% 0.1 (0.3) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:7.29% / 15.27%

Stack Uptimes

  • dreamstate_1:7.34%
  • dreamstate_2:3.56%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 8.0 23.8s 15.0s 21.2s 93.03% 93.72% 8.0 (8.0) 12.2

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 70.3s
  • trigger_min/max:0.0s / 57.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.8s
  • uptime_min/max:90.22% / 95.99%

Stack Uptimes

  • eclipse_lunar_1:93.03%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.4s 38.4s 19.1s 52.40% 54.32% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.0s
  • trigger_min/max:12.0s / 84.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.72% / 59.59%

Stack Uptimes

  • eclipse_solar_1:52.40%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.1s 306.1s 27.4s 12.93% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.8s 64.8s 7.9s 13.51% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 89.5s
  • trigger_min/max:60.0s / 89.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.80% / 15.59%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.4s 38.4s 19.1s 52.40% 55.03% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.0s
  • trigger_min/max:12.0s / 84.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.72% / 59.59%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.40%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 23.96% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.7s
  • trigger_min/max:90.0s / 121.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.35% / 26.98%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.21%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.39% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.48% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.39%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.0s 69.3s 0.9s 0.75% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 342.9s
  • trigger_min/max:0.0s / 342.9s
  • trigger_pct:14.96%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 4.37%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.5 34.3s 34.3s 30.1s 91.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.7s / 47.8s
  • trigger_min/max:20.7s / 47.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.8s
  • uptime_min/max:87.58% / 94.73%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.20%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.67%
  • primordial_arcanic_pulsar_20:8.31%
  • primordial_arcanic_pulsar_25:8.52%
  • primordial_arcanic_pulsar_30:8.24%
  • primordial_arcanic_pulsar_35:8.68%
  • primordial_arcanic_pulsar_40:9.08%
  • primordial_arcanic_pulsar_45:9.02%
  • primordial_arcanic_pulsar_50:8.90%
  • primordial_arcanic_pulsar_55:8.92%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.4 15.6s 13.5s 6.7s 43.82% 43.00% 3.4 (3.4) 19.3

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.6s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:38.53% / 46.94%

Stack Uptimes

  • solstice_1:43.82%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.6 0.0 142.9s 2.9s 295.4s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.1s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:4.3s / 357.8s
  • uptime_min/max:98.42% / 99.48%

Stack Uptimes

  • starfall_1:5.52%
  • starfall_2:33.35%
  • starfall_3:42.06%
  • starfall_4:14.50%
  • starfall_5:3.11%
  • starfall_6:0.33%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.7 14.5s 2.9s 13.9s 97.51% 0.00% 41.4 (41.4) 5.9

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.4s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.28% / 99.28%

Stack Uptimes

  • starlord_1:12.79%
  • starlord_2:17.87%
  • starlord_3:66.86%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.7 2.6 12.9s 11.5s 1.6s 12.29% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 50.7s
  • trigger_min/max:0.0s / 50.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.7s
  • uptime_min/max:3.85% / 24.45%

Stack Uptimes

  • umbral_embrace_1:12.29%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.1 47.4s 5.6s 42.7s 90.07% 0.00% 54.3 (54.3) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 330.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.8s
  • uptime_min/max:68.81% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.07%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.4s 23.46% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 234.4s
  • trigger_min/max:0.0s / 208.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.8s
  • uptime_min/max:4.63% / 58.88%

Stack Uptimes

  • wafting_devotion_1:23.46%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.5s 23.2s 47.9s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.68% 0.0s 0.0s 1.1s
Astral Smolder 73.91% 64.85% 85.10% 4.2s 0.0s 44.6s
Incarnation (Total) 52.40% 46.72% 59.59% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.08% 28.74% 34.76% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.63% 33.14% 46.78% 9.4s 0.0s 15.0s
No Eclipse 6.93% 4.01% 9.78% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.0070.00029.48025.6716.60072.655

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.11100.0%0.000.0%0.000.0%0.000.0%
Starfire2.362.0%0.000.0%49.7542.3%65.5855.7%
Starfall21.107.1%0.000.0%118.5240.1%155.9952.8%
Fury of Elune20.652.7%0.000.0%143.0518.9%592.7278.4%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31_2p
Fury of EluneAstral Power80.71241.765.85%3.000.390.16%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.58465.2611.25%29.862.110.45%
Shooting Stars (Moonfire)Astral Power232.83465.4011.25%2.000.270.06%
Shooting Stars (Sunfire)Astral Power234.70469.1511.34%2.000.260.06%
StarfireAstral Power117.692209.0753.41%18.7733.521.49%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.11261.136.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31_2p
StarfallAstral Power 104.034098.12100.00%39.4039.5516756.18
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 719520.0 3302.69 3820.01 2577651.8 564605.9 -17990.9 719520.0
Astral Power 20.0 13.81 13.63 36.5 53.2 0.2 100.0

Statistics & Data Analysis

Fight Length
460 T31_2p Fight Length
Count 8410
Mean 299.45
Minimum 240.02
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7972
5th Percentile 246.00
95th Percentile 354.14
( 95th Percentile - 5th Percentile ) 108.14
Mean Distribution
Standard Deviation 0.3794
95.00% Confidence Interval ( 298.71 - 300.20 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 519
0.1% Error 51871
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1034
DPS
460 T31_2p Damage Per Second
Count 8410
Mean 707726.23
Minimum 653862.76
Maximum 777021.02
Spread ( max - min ) 123158.26
Range [ ( max - min ) / 2 * 100% ] 8.70%
Standard Deviation 16503.4633
5th Percentile 681621.73
95th Percentile 736020.04
( 95th Percentile - 5th Percentile ) 54398.31
Mean Distribution
Standard Deviation 179.9605
95.00% Confidence Interval ( 707373.51 - 708078.94 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2089
0.1 Scale Factor Error with Delta=300 2325059
0.05 Scale Factor Error with Delta=300 9300234
0.01 Scale Factor Error with Delta=300 232505832
Priority Target DPS
460 T31_2p Priority Target Damage Per Second
Count 8410
Mean 129168.32
Minimum 112318.18
Maximum 146597.30
Spread ( max - min ) 34279.12
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 4008.0363
5th Percentile 122703.62
95th Percentile 135914.45
( 95th Percentile - 5th Percentile ) 13210.83
Mean Distribution
Standard Deviation 43.7053
95.00% Confidence Interval ( 129082.66 - 129253.98 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3699
0.1 Scale Factor Error with Delta=300 137135
0.05 Scale Factor Error with Delta=300 548539
0.01 Scale Factor Error with Delta=300 13713458
DPS(e)
460 T31_2p Damage Per Second (Effective)
Count 8410
Mean 707726.23
Minimum 653862.76
Maximum 777021.02
Spread ( max - min ) 123158.26
Range [ ( max - min ) / 2 * 100% ] 8.70%
Damage
460 T31_2p Damage
Count 8410
Mean 211606605.03
Minimum 167022992.25
Maximum 261391150.25
Spread ( max - min ) 94368158.00
Range [ ( max - min ) / 2 * 100% ] 22.30%
DTPS
460 T31_2p Damage Taken Per Second
Count 8410
Mean 3818.64
Minimum 942.20
Maximum 8019.80
Spread ( max - min ) 7077.59
Range [ ( max - min ) / 2 * 100% ] 92.67%
HPS
460 T31_2p Healing Per Second
Count 8410
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31_2p Healing Per Second (Effective)
Count 8410
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31_2p Heal
Count 8410
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31_2p Healing Taken Per Second
Count 8410
Mean 3293.30
Minimum 626.99
Maximum 7265.61
Spread ( max - min ) 6638.62
Range [ ( max - min ) / 2 * 100% ] 100.79%
TMI
460 T31_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.67 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.06 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.55 starfall,if=variable.starfall_condition1
M 1.35 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.19 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.09 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.87 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJLJMLNDEPQRRLRLLRRLRKLQRQRRRLRRLRLRKLLQRRLRRLRRLRKLQROOQRRLRLRRLQQRRPOLORLLRKLRQRRQROORLRFLRLQRERRLRLRKLOOQRLRLRRLRQOORQRLRRLPRLQQRRLROOLRLRLRQRRQROORLRKLLRQRRRLRLOOKLFRLQRRNERRLRLRKLPQRQRRLLRLRKLQRQRRRRLRRKLQRQROORLLRRKLQRQRRRLRLOLORLRQRQRRRRKLOOQRFLRLPRERKLQQRLROLORRLRKLRR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31_2p 0.0/100: 0% astral_power
Pre precombat 1 food 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31_2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.938 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.877 aoe J moonfire enemy2 85.2/100: 85% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.815 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.753 aoe J moonfire enemy4 54.2/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate, undulating_sporecloak, corrupting_rage
0:04.656 aoe M starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.467 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:06.368 aoe N incarnation_chosen_of_elune Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), umbral_embrace, undulating_sporecloak, corrupting_rage
0:06.368 default D potion Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), undulating_sporecloak, corrupting_rage
0:06.368 default E use_items Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:06.368 aoe P fury_of_elune Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.159 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.950 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.704 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.459 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.222 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.363 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:12.126 aoe L starfall Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.888 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:14.030 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.173 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.934 aoe R starfire Fluffy_Pillow 47.4/100: 47% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.075 aoe K cancel_buff Fluffy_Pillow 70.6/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.075 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.928 aoe Q starfall Fluffy_Pillow 35.6/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.748 aoe R starfire Fluffy_Pillow 2.6/100: 3% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), umbral_embrace, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.933 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.724 aoe R starfire Fluffy_Pillow 20.8/100: 21% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.865 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.007 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:24.149 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.911 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:26.053 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:27.195 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.958 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.099 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.860 aoe R starfire Fluffy_Pillow 71.2/100: 71% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.000 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.000 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.854 aoe L starfall Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.672 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.461 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), umbral_embrace, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.604 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.745 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:36.510 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:37.653 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:38.794 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:39.557 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:40.698 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:42.182 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:43.171 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.162 aoe K cancel_buff Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.162 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:45.270 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:46.334 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), umbral_embrace, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:47.871 aoe O wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:48.898 aoe O wrath Fluffy_Pillow 53.6/100: 54% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:49.652 aoe Q starfall Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:50.780 aoe R starfire Fluffy_Pillow 24.6/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:51.760 aoe R starfire Fluffy_Pillow 49.8/100: 50% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:53.391 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:54.480 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:56.110 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:57.198 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:58.680 aoe R starfire Fluffy_Pillow 81.4/100: 81% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:00.164 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_aerwynn_static, corrupting_rage
1:01.272 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage
1:02.338 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
1:03.366 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
1:04.847 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:06.218 aoe P fury_of_elune Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:07.285 aoe O wrath Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:08.201 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.209 aoe O wrath Fluffy_Pillow 35.4/100: 35% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.964 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:10.869 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:11.876 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:12.882 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:14.390 aoe K cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:14.390 aoe L starfall Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:15.518 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:17.142 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:18.224 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:19.788 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:21.478 aoe Q starfall Fluffy_Pillow 62.4/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:22.608 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:24.239 aoe O wrath Fluffy_Pillow 40.6/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:25.328 aoe O wrath Fluffy_Pillow 50.6/100: 51% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:26.083 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:27.063 aoe L starfall Fluffy_Pillow 87.8/100: 88% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:28.150 aoe R starfire Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:29.781 default F natures_vigil 460 T31_2p 74.0/100: 74% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:30.000 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:31.218 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:32.972 aoe L starfall Fluffy_Pillow 56.2/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:34.142 aoe Q starfall Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:35.168 aoe R starfire Fluffy_Pillow 16.2/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:36.651 default E use_items Fluffy_Pillow 45.4/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:36.651 aoe R starfire Fluffy_Pillow 45.4/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:38.134 aoe R starfire Fluffy_Pillow 72.6/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:39.616 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:40.606 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
1:42.090 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
1:43.079 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
1:44.561 aoe K cancel_buff Fluffy_Pillow 80.2/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:44.561 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:45.668 aoe O wrath Fluffy_Pillow 47.2/100: 47% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
1:46.423 aoe O wrath Fluffy_Pillow 57.2/100: 57% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
1:47.179 aoe Q starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:48.353 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
1:50.041 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
1:51.169 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
1:52.799 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
1:53.886 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
1:55.517 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
1:57.149 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:58.237 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:59.869 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:01.088 aoe O wrath Fluffy_Pillow 14.2/100: 14% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:02.258 aoe O wrath Fluffy_Pillow 26.2/100: 26% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:03.012 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:04.066 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:05.237 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:06.928 aoe L starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:08.055 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:09.687 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:11.316 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:12.405 aoe P fury_of_elune Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:13.395 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:14.880 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:15.986 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:17.052 aoe Q starfall Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:18.077 aoe R starfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:19.559 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:21.043 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:22.033 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:23.515 aoe O wrath Fluffy_Pillow 57.6/100: 58% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:24.271 aoe O wrath Fluffy_Pillow 69.6/100: 70% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:25.025 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:26.031 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:27.538 aoe L starfall Fluffy_Pillow 97.8/100: 98% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:28.543 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:30.052 aoe L starfall Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:31.177 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:32.801 aoe Q starfall Fluffy_Pillow 66.2/100: 66% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:33.883 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:35.447 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:37.012 aoe Q starfall Fluffy_Pillow 63.6/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:38.055 aoe R starfire Fluffy_Pillow 20.6/100: 21% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:39.560 aoe O wrath Fluffy_Pillow 43.8/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:40.566 aoe O wrath Fluffy_Pillow 57.8/100: 58% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:41.319 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:42.225 aoe L starfall Fluffy_Pillow 95.0/100: 95% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:43.231 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:44.739 aoe K cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:44.739 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:45.865 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:46.948 aoe R starfire Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:48.370 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:49.318 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:50.689 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.171 aoe R starfire Fluffy_Pillow 81.8/100: 82% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.654 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.643 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.125 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.115 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.105 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.860 aoe K cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.860 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), umbral_embrace, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.079 default F natures_vigil 460 T31_2p 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.079 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.134 aoe L starfall Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:02.305 aoe Q starfall Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:03.434 aoe R starfire Fluffy_Pillow 15.4/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:05.065 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:06.695 aoe N incarnation_chosen_of_elune Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:06.695 default E use_items Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:06.695 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:07.586 aoe R starfire Fluffy_Pillow 81.0/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:08.478 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:09.468 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:10.951 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:11.940 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:13.422 aoe K cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:13.422 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:14.529 aoe P fury_of_elune Fluffy_Pillow 53.4/100: 53% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:15.595 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:16.660 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:18.199 aoe Q starfall Fluffy_Pillow 62.6/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:19.226 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
3:20.596 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
3:21.967 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:22.882 aoe L starfall Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:23.800 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:25.171 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
3:26.089 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
3:27.460 aoe K cancel_buff Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:27.460 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:28.485 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:29.471 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:30.893 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:31.844 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:33.216 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:34.586 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:36.067 aoe R starfire Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:37.549 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:38.538 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:40.020 aoe R starfire Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:41.503 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:41.503 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, best_friends_with_pip_static, undulating_sporecloak
3:42.610 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak
3:43.675 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak
3:45.212 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak
3:46.239 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:47.722 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak
3:48.712 aoe O wrath Fluffy_Pillow 53.4/100: 53% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:49.466 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:50.371 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:51.376 aoe L starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:52.383 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:53.891 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:55.399 aoe K cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.399 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.524 aoe Q starfall Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:57.509 aoe R starfire Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.931 aoe Q starfall Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.880 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.251 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.621 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.991 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:04.981 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:06.463 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:07.451 aoe O wrath Fluffy_Pillow 42.0/100: 42% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:08.205 aoe L starfall Fluffy_Pillow 54.0/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
4:09.293 aoe O wrath Fluffy_Pillow 9.0/100: 9% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage
4:10.046 aoe R starfire Fluffy_Pillow 19.0/100: 19% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak
4:11.677 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_pip_static, undulating_sporecloak
4:12.895 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak
4:14.652 aoe Q starfall Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak
4:15.824 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak
4:17.517 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak
4:18.646 aoe R starfire Fluffy_Pillow 5.6/100: 6% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak
4:20.278 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak
4:21.908 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak
4:23.537 aoe R starfire Fluffy_Pillow 71.2/100: 71% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak
4:25.167 aoe K cancel_buff Fluffy_Pillow 87.2/100: 87% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:25.167 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:26.385 aoe O wrath Fluffy_Pillow 42.2/100: 42% astral_power primordial_arcanic_pulsar(45), starfall, starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:27.140 aoe O wrath Fluffy_Pillow 56.2/100: 56% astral_power primordial_arcanic_pulsar(45), starfall, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:27.895 aoe Q starfall Fluffy_Pillow 66.2/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:29.066 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:30.756 default F natures_vigil 460 T31_2p 90.4/100: 90% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:30.756 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:31.886 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:33.517 aoe L starfall Fluffy_Pillow 76.6/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:34.605 aoe P fury_of_elune Fluffy_Pillow 35.6/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:35.594 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:37.076 default E use_items Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:37.076 aoe R starfire Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
4:38.558 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
4:38.558 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
4:39.666 aoe Q starfall Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
4:40.731 aoe Q starfall Fluffy_Pillow 53.0/100: 53% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
4:41.757 aoe R starfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
4:43.129 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
4:44.045 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
4:45.417 aoe O wrath Fluffy_Pillow 69.4/100: 69% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
4:46.332 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(3), dreamstate(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
4:47.338 aoe O wrath Fluffy_Pillow 34.4/100: 34% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
4:48.093 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
4:48.999 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
4:50.507 aoe L starfall Fluffy_Pillow 96.8/100: 97% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
4:51.513 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
4:53.021 aoe K cancel_buff Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
4:53.021 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
4:54.148 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
4:55.771 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35976 34263 30553
Intellect 2089 0 13622 12804 10106 (6209)
Spirit 0 0 0 0 0
Health 719520 719520 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13622 12804 0
Crit 27.22% 21.01% 2881
Haste 23.52% 23.52% 3791
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14167 13316 0
Mastery 27.77% 27.77% 7056
Armor 4552 4552 4552
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 469.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=468.75
# gear_stamina=30553
# gear_intellect=10106
# gear_crit_rating=2881
# gear_haste_rating=3791
# gear_mastery_rating=7056
# gear_versatility_rating=793
# gear_armor=4552
# set_bonus=tier31_2pc=1

460 T31_4p : 760057 dps, 138418 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
760057.1 760057.1 379.3 / 0.050% 73381.4 / 9.7% 55698.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.9 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31_4p 760057
Astral Smolder 114135 15.0% 373.3 0.86s 91423 0 Periodic 734.2 46484 0 46484 0.0% 81.7%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 373.29 0.00 734.18 734.18 285.80 0.0000 2.0000 34127247.51 34127247.51 0.00% 23241.60 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.18 547 926 46484.44 3885 212505 46544.18 40585 55521 34127248 34127248 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 22523 3.0% 5.1 64.92s 1314570 1345147 Direct 756.3 5694 11949 8904 51.3%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 756.35 0.00 0.00 0.00 0.9774 0.0000 6733806.26 6733806.26 0.00% 1345147.08 1345147.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.69% 368.25 213 523 5694.17 2706 18412 5705.07 4985 6595 2096763 2096763 0.00%
crit 51.31% 388.09 264 576 11948.96 5413 36236 11953.78 10641 13602 4637043 4637043 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2986 0.4% 16.9 16.95s 53114 0 Direct 16.9 41751 83383 53124 27.3%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.86 16.86 0.00 0.00 0.00 0.0000 0.0000 895608.14 895608.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.67% 12.25 3 28 41751.15 27630 160353 41612.72 27822 103437 511604 511604 0.00%
crit 27.33% 4.61 0 13 83383.21 55259 320706 82731.00 0 317410 384004 384004 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2878 0.4% 33.8 8.65s 25504 0 Direct 33.7 20087 40143 25571 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.78 33.69 0.00 0.00 0.00 0.0000 0.0000 861529.64 861529.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.65% 24.48 9 48 20086.86 19556 22699 20086.55 19779 20860 491695 491695 0.00%
crit 27.35% 9.21 0 24 40142.79 39112 45399 40137.47 0 42596 369834 369834 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 64376 8.5% 3.0 1.11s 6422503 6896030 Direct 6.0 6097 12181 9020 48.0%
Periodic 1801.0 7525 15250 10669 40.7% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1800.98 1800.98 0.00 0.9316 0.9896 19267507.60 19267507.60 0.00% 10794.01 6896029.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.97% 3.12 0 6 6096.84 6018 6986 6014.75 0 6986 19013 19013 0.00%
crit 48.03% 2.88 0 6 12181.32 12037 13972 11957.52 0 13972 35100 35100 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.31% 1068.10 802 1362 7525.03 5650 11884 7524.87 7339 7768 8037332 8037332 0.00%
crit 40.69% 732.88 532 951 15249.81 11300 23768 15251.69 14806 15834 11176063 11176063 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (65593) 0.0% (8.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 16220 2.1% 232.8 1.48s 20849 0 Direct 232.2 13403 28281 20901 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 232.75 232.17 0.00 0.00 0.00 0.0000 0.0000 4852578.24 4852578.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.60% 115.16 71 166 13402.88 9121 24984 13408.81 12341 14421 1543467 1543467 0.00%
crit 50.40% 117.01 76 168 28281.48 18242 49881 28302.76 26458 30559 3309112 3309112 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 16281 2.1% 234.5 1.48s 20773 0 Direct 233.9 13367 28183 20827 50.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.49 233.89 0.00 0.00 0.00 0.0000 0.0000 4871163.63 4871163.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.65% 116.13 67 178 13366.99 8453 25333 13371.78 12368 14473 1552232 1552232 0.00%
crit 50.35% 117.76 71 165 28183.43 16906 49881 28204.82 26360 30535 3318931 3318931 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 33092 4.4% 15.6 19.38s 635616 0 Direct 93.2 68184 144193 106246 50.1%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.58 93.19 0.00 0.00 0.00 0.0000 0.0000 9900379.40 9900379.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.92% 46.52 21 76 68184.22 34845 247612 68236.70 53809 86534 3171993 3171993 0.00%
crit 50.08% 46.66 18 82 144193.08 69691 495224 144284.35 103892 180600 6728387 6728387 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 251340 33.1% 103.6 2.87s 725446 709522 Direct 1766.7 28483 60394 42536 44.0%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.59 1766.74 0.00 0.00 0.00 1.0224 0.0000 75146925.77 75146925.77 0.00% 709522.30 709522.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.96% 988.71 721 1271 28483.33 6428 108698 28546.04 25777 31558 28160311 28160311 0.00%
crit 44.04% 778.04 574 1006 60394.49 12855 217396 60502.20 55501 67255 46986615 46986615 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.39
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.20
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 173264 22.8% 116.7 2.53s 444245 315334 Direct 706.0 46632 98704 73413 51.4%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.66 705.95 0.00 0.00 0.00 1.4088 0.0000 51825182.00 51825182.00 0.00% 315334.24 315334.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.57% 342.86 234 449 46631.75 6334 205631 46646.58 41572 53462 15987612 15987612 0.00%
crit 51.43% 363.09 256 474 98703.62 12669 412757 98743.43 87922 112985 35837570 35837570 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.37
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.84
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 53925 7.1% 1.0 0.00s 16127859 17175569 Direct 1.0 4786 9569 6099 27.5%
Periodic 1813.9 6327 13276 8888 36.9% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1813.92 1813.92 0.00 0.9395 0.9892 16127859.24 16127859.24 0.00% 8983.34 17175568.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 0.73 0 1 4785.71 4758 4813 3471.87 0 4813 3472 3472 0.00%
crit 27.45% 0.27 0 1 9569.39 9515 9627 2627.10 0 9627 2627 2627 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.14% 1145.39 854 1450 6326.93 4669 10804 6330.07 6137 6590 7246670 7246670 0.00%
crit 36.86% 668.53 490 891 13275.85 9339 21608 13282.91 12798 13875 8875091 8875091 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5502) 0.0% (0.7%) 8.3 32.36s 197856 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2873 0.4% 8.3 32.36s 103310 0 Direct 50.0 13529 27033 17219 27.3%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 49.97 0.00 0.00 0.00 0.0000 0.0000 860341.48 860341.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.68% 36.31 5 98 13528.61 13165 15281 13527.72 13196 14846 491267 491267 0.00%
crit 27.32% 13.65 1 40 27032.77 26330 30563 27035.99 26432 30249 369075 369075 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2629 0.3% 16.0 15.70s 49152 0 Direct 96.1 6437 12863 8192 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.02 96.11 0.00 0.00 0.00 0.0000 0.0000 787356.42 787356.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.68% 69.86 14 185 6436.65 6264 7271 6436.10 6288 6885 449645 449645 0.00%
crit 27.32% 26.25 4 69 12863.02 12529 14543 12864.26 12546 13923 337712 337712 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3534 0.5% 26.1 10.46s 40749 52668 Direct 26.0 29441 58699 40962 39.4%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.11 25.97 0.00 0.00 0.00 0.7737 0.0000 1063784.48 1063784.48 0.00% 52667.81 52667.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.62% 15.74 5 27 29441.46 12962 56627 29389.88 21357 37293 463450 463450 0.00%
crit 39.38% 10.23 2 22 58698.92 25924 111501 58567.30 30158 81815 600334 600334 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.18
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31_4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 281.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.17 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.42s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 305.50s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.6 5.6 17.6s 13.6s 9.5s 55.75% 57.59% 5.6 (18.4) 17.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.7s
  • trigger_min/max:0.0s / 37.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:51.67% / 59.23%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.78%
  • balance_of_all_things_arcane_2:6.17%
  • balance_of_all_things_arcane_3:6.64%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.51%
  • balance_of_all_things_arcane_7:7.62%
  • balance_of_all_things_arcane_8:7.68%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.0s 30.0s 7.9s 26.93% 29.98% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.2s
  • trigger_min/max:5.6s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.44% / 29.99%

Stack Uptimes

  • balance_of_all_things_nature_1:3.33%
  • balance_of_all_things_nature_2:3.34%
  • balance_of_all_things_nature_3:3.35%
  • balance_of_all_things_nature_4:3.36%
  • balance_of_all_things_nature_5:3.37%
  • balance_of_all_things_nature_6:3.38%
  • balance_of_all_things_nature_7:3.39%
  • balance_of_all_things_nature_8:3.40%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 14.9 85.5 20.6s 3.0s 17.7s 88.26% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.2s
  • trigger_min/max:0.8s / 13.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:81.01% / 93.04%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.17%
  • balance_t31_4pc_buff_lunar_2:13.76%
  • balance_t31_4pc_buff_lunar_3:14.06%
  • balance_t31_4pc_buff_lunar_4:11.60%
  • balance_t31_4pc_buff_lunar_5:35.67%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 56.0 38.3s 4.5s 18.9s 51.61% 0.00% 25.8 (25.8) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.7s
  • trigger_min/max:0.8s / 41.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:45.49% / 59.41%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.58%
  • balance_t31_4pc_buff_solar_2:6.42%
  • balance_t31_4pc_buff_solar_3:6.31%
  • balance_t31_4pc_buff_solar_4:6.52%
  • balance_t31_4pc_buff_solar_5:24.77%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 319.3s
  • trigger_min/max:12.0s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.33%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.4s 70.2s 45.1s 33.10% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.2s / 341.5s
  • trigger_min/max:12.0s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 311.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.10%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.9s 69.9s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 332.2s
  • trigger_min/max:12.0s / 332.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.40%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.4s 69.9s 45.3s 33.53% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 348.3s
  • trigger_min/max:12.0s / 332.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 292.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.53%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.1s 69.1s 10.8s 10.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.3s
  • trigger_min/max:12.0s / 338.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.63%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.93%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.94%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.7s 69.1s 45.2s 33.37% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 346.6s
  • trigger_min/max:12.0s / 338.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 293.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.37%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.1s 58.3s 50.0s 80.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 345.0s
  • trigger_min/max:15.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.2s
  • uptime_min/max:50.22% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.19%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.1 20.6s 21.4s 2.2s 10.87% 20.53% 0.1 (0.3) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.6s
  • uptime_min/max:7.06% / 15.47%

Stack Uptimes

  • dreamstate_1:7.33%
  • dreamstate_2:3.54%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 8.0 23.9s 15.0s 21.2s 93.03% 93.72% 8.0 (8.0) 12.2

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 70.5s
  • trigger_min/max:0.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.6s
  • uptime_min/max:89.20% / 96.05%

Stack Uptimes

  • eclipse_lunar_1:93.03%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.4s 38.4s 19.1s 52.35% 54.27% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.7s
  • trigger_min/max:12.0s / 84.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.70% / 59.75%

Stack Uptimes

  • eclipse_solar_1:52.35%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.8s 305.8s 27.3s 12.91% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.8s
  • trigger_min/max:300.0s / 325.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.75% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.91%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.8s 64.8s 7.9s 13.51% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.7s
  • trigger_min/max:60.0s / 88.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.01% / 15.55%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.4s 38.4s 19.1s 52.35% 54.98% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.7s
  • trigger_min/max:12.0s / 84.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.70% / 59.75%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.35%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 120.9s
  • trigger_min/max:90.0s / 120.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.19% / 27.00%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.21%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.5s 69.8s 0.9s 0.75% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 331.9s
  • trigger_min/max:0.1s / 331.9s
  • trigger_pct:14.81%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:0.00% / 5.59%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.4 34.3s 34.3s 30.1s 91.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 46.7s
  • trigger_min/max:20.9s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s
  • uptime_min/max:87.54% / 94.88%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.20%
  • primordial_arcanic_pulsar_10:6.71%
  • primordial_arcanic_pulsar_15:7.68%
  • primordial_arcanic_pulsar_20:8.31%
  • primordial_arcanic_pulsar_25:8.50%
  • primordial_arcanic_pulsar_30:8.21%
  • primordial_arcanic_pulsar_35:8.71%
  • primordial_arcanic_pulsar_40:9.10%
  • primordial_arcanic_pulsar_45:9.02%
  • primordial_arcanic_pulsar_50:8.90%
  • primordial_arcanic_pulsar_55:8.93%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.4 15.6s 13.6s 6.6s 43.80% 42.98% 3.4 (3.4) 19.3

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.9s
  • trigger_min/max:0.0s / 37.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.04% / 47.04%

Stack Uptimes

  • solstice_1:43.80%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.6 0.0 143.0s 2.9s 295.8s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.4s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:4.3s / 357.9s
  • uptime_min/max:98.34% / 99.48%

Stack Uptimes

  • starfall_1:5.57%
  • starfall_2:33.44%
  • starfall_3:41.95%
  • starfall_4:14.47%
  • starfall_5:3.10%
  • starfall_6:0.34%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.6 14.5s 2.9s 13.9s 97.51% 0.00% 41.3 (41.3) 5.9

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.8s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.76% / 99.33%

Stack Uptimes

  • starlord_1:12.80%
  • starlord_2:17.90%
  • starlord_3:66.80%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.8s 11.5s 1.6s 12.34% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 52.9s
  • trigger_min/max:0.0s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:4.34% / 22.96%

Stack Uptimes

  • umbral_embrace_1:12.34%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.2 47.8s 5.5s 43.2s 90.16% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 315.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.4s
  • uptime_min/max:72.75% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.16%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.2s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 233.8s
  • trigger_min/max:0.0s / 233.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.7s
  • uptime_min/max:5.13% / 57.49%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.5s 23.7s 47.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.68% 0.0s 0.0s 1.1s
Astral Smolder 73.84% 63.31% 85.15% 4.2s 0.0s 47.0s
Incarnation (Total) 52.35% 46.70% 59.75% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.05% 29.21% 34.96% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.69% 33.17% 47.41% 9.5s 0.0s 15.0s
No Eclipse 6.93% 3.95% 10.80% 1.7s 0.0s 4.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.0040.00028.67225.6355.77480.905

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.11100.0%0.000.0%0.000.0%0.000.0%
Starfire2.402.0%0.000.0%49.8142.3%65.4555.6%
Starfall21.077.1%0.000.0%118.7540.2%155.9352.7%
Fury of Elune20.352.7%0.000.0%143.6719.0%592.3278.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31_4p
Fury of EluneAstral Power80.72241.705.85%2.990.460.19%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.58465.4111.26%29.881.890.40%
Shooting Stars (Moonfire)Astral Power232.76465.2611.25%2.000.250.05%
Shooting Stars (Sunfire)Astral Power234.50468.7411.34%2.000.260.05%
StarfireAstral Power117.662208.4153.41%18.7733.391.49%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.11261.056.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31_4p
StarfallAstral Power 103.944095.27100.00%39.4039.5318349.67
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 708220.0 3260.41 3775.27 2847560.3 553970.8 7820.5 708220.0
Astral Power 20.0 13.80 13.62 36.3 53.2 0.0 100.0

Statistics & Data Analysis

Fight Length
460 T31_4p Fight Length
Count 9376
Mean 299.59
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.5917
5th Percentile 245.79
95th Percentile 354.05
( 95th Percentile - 5th Percentile ) 108.26
Mean Distribution
Standard Deviation 0.3572
95.00% Confidence Interval ( 298.89 - 300.29 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51214
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
460 T31_4p Damage Per Second
Count 9376
Mean 760057.14
Minimum 700844.50
Maximum 840398.44
Spread ( max - min ) 139553.94
Range [ ( max - min ) / 2 * 100% ] 9.18%
Standard Deviation 18736.8019
5th Percentile 730958.32
95th Percentile 792211.56
( 95th Percentile - 5th Percentile ) 61253.24
Mean Distribution
Standard Deviation 193.5025
95.00% Confidence Interval ( 759677.88 - 760436.39 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2335
0.1 Scale Factor Error with Delta=300 2996917
0.05 Scale Factor Error with Delta=300 11987665
0.01 Scale Factor Error with Delta=300 299691621
Priority Target DPS
460 T31_4p Priority Target Damage Per Second
Count 9376
Mean 138418.00
Minimum 124430.00
Maximum 156483.34
Spread ( max - min ) 32053.35
Range [ ( max - min ) / 2 * 100% ] 11.58%
Standard Deviation 4401.6098
5th Percentile 131523.45
95th Percentile 145956.55
( 95th Percentile - 5th Percentile ) 14433.09
Mean Distribution
Standard Deviation 45.4572
95.00% Confidence Interval ( 138328.90 - 138507.09 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3885
0.1 Scale Factor Error with Delta=300 165390
0.05 Scale Factor Error with Delta=300 661557
0.01 Scale Factor Error with Delta=300 16538905
DPS(e)
460 T31_4p Damage Per Second (Effective)
Count 9376
Mean 760057.14
Minimum 700844.50
Maximum 840398.44
Spread ( max - min ) 139553.94
Range [ ( max - min ) / 2 * 100% ] 9.18%
Damage
460 T31_4p Damage
Count 9376
Mean 227321269.82
Minimum 175928519.20
Maximum 283943687.86
Spread ( max - min ) 108015168.66
Range [ ( max - min ) / 2 * 100% ] 23.76%
DTPS
460 T31_4p Damage Taken Per Second
Count 9376
Mean 3774.19
Minimum 877.65
Maximum 7238.51
Spread ( max - min ) 6360.86
Range [ ( max - min ) / 2 * 100% ] 84.27%
HPS
460 T31_4p Healing Per Second
Count 9376
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31_4p Healing Per Second (Effective)
Count 9376
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31_4p Heal
Count 9376
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31_4p Healing Taken Per Second
Count 9376
Mean 3251.49
Minimum 483.10
Maximum 6765.10
Spread ( max - min ) 6282.00
Range [ ( max - min ) / 2 * 100% ] 96.60%
TMI
460 T31_4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31_4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31_4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.09 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.39 starfall,if=variable.starfall_condition1
M 1.37 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.18 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.20 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.84 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJLJMLNDEPQRRLRLRLRLRKLLRQRRLRRLRLRLKLRLQRRRRLRLRRKLQROOQRRLRLRRLQQRRPOOLRLLRKLRQRRQROORLRFQRLQRERRLRLROKLOQRRLRLRRLRQOORQRRLRLPRKLQQRRRLOLORLRLRQRRQROORKLRLRQRRLRLRKLQFOOMQRRLNERLRRKLPQQRRLRLRLKLQRQRRRRLRKLQRQRRRLRLOOKLRQRQRRRLRLKLOOLRQRRRLRRKLROOLRLFRLRRKLPQERQRRLRLLOLORQRQRRQRRRLODO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31_4p 0.0/100: 0% astral_power
Pre precombat 1 food 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31_4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.940 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.880 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.820 aoe L starfall Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.759 aoe J moonfire enemy4 24.2/100: 24% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, undulating_sporecloak, corrupting_rage
0:04.661 aoe M starfire Fluffy_Pillow 68.2/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:05.475 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:06.379 aoe N incarnation_chosen_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage
0:06.379 default D potion Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage
0:06.379 default E use_items Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:06.379 aoe P fury_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.170 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.961 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.717 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.473 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.236 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.379 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.141 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.284 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:14.047 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.190 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.953 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.095 aoe K cancel_buff Fluffy_Pillow 82.6/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.095 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.951 aoe L starfall Fluffy_Pillow 49.6/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.772 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.958 aoe Q starfall Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.751 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.893 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.036 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.798 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.940 aoe R starfire Fluffy_Pillow 73.4/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:26.083 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.846 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.989 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.751 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.894 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.658 aoe K cancel_buff Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.658 aoe L starfall Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.514 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.745 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.567 aoe Q starfall Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.359 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.502 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:36.645 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:37.787 aoe R starfire Fluffy_Pillow 79.8/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:38.931 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:39.694 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:40.838 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:41.827 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:43.310 aoe R starfire Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.793 aoe K cancel_buff Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.793 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:45.901 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:46.967 aoe R starfire Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:48.505 aoe O wrath Fluffy_Pillow 41.6/100: 42% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
0:49.260 aoe O wrath Fluffy_Pillow 51.6/100: 52% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
0:50.013 aoe Q starfall Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
0:51.144 aoe R starfire Fluffy_Pillow 24.6/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:52.776 aoe R starfire Fluffy_Pillow 49.8/100: 50% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:54.409 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:55.499 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage
0:57.130 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage
0:58.220 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage
0:59.704 aoe R starfire Fluffy_Pillow 79.4/100: 79% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage
1:01.186 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage
1:02.296 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), undulating_sporecloak, corrupting_rage
1:03.363 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), undulating_sporecloak, corrupting_rage
1:04.390 aoe R starfire Fluffy_Pillow 3.0/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), undulating_sporecloak, corrupting_rage
1:05.873 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), undulating_sporecloak, corrupting_rage
1:07.358 aoe P fury_of_elune Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), undulating_sporecloak, wafting_devotion, corrupting_rage
1:08.274 aoe O wrath Fluffy_Pillow 52.4/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.190 aoe O wrath Fluffy_Pillow 70.4/100: 70% astral_power fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn(4), undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.945 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:10.952 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(2), wafting_devotion, corrupting_rage
1:11.857 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn, wafting_devotion, corrupting_rage
1:12.865 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), wafting_devotion, corrupting_rage
1:13.872 aoe R starfire Fluffy_Pillow 46.6/100: 47% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), wafting_devotion, corrupting_rage
1:15.381 aoe K cancel_buff Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), undulating_sporecloak, wafting_devotion, corrupting_rage
1:15.381 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), undulating_sporecloak, wafting_devotion, corrupting_rage
1:16.508 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(4), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), undulating_sporecloak, wafting_devotion, corrupting_rage
1:18.131 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(7), undulating_sporecloak, wafting_devotion, corrupting_rage
1:19.214 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), undulating_sporecloak, wafting_devotion, corrupting_rage
1:20.778 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), undulating_sporecloak, wafting_devotion, corrupting_rage
1:22.342 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:23.386 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:24.896 aoe O wrath Fluffy_Pillow 29.4/100: 29% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, undulating_sporecloak, wafting_devotion, corrupting_rage
1:25.651 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:26.405 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:27.914 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:28.921 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, undulating_sporecloak, wafting_devotion, corrupting_rage
1:30.432 default F natures_vigil 460 T31_4p 66.8/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, undulating_sporecloak, wafting_devotion, corrupting_rage
1:30.432 aoe Q starfall Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, undulating_sporecloak, wafting_devotion, corrupting_rage
1:31.559 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_lunar(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:33.184 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), undulating_sporecloak, wafting_devotion, corrupting_rage
1:34.268 aoe Q starfall Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), undulating_sporecloak, wafting_devotion, corrupting_rage
1:35.217 aoe R starfire Fluffy_Pillow 13.0/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, wafting_devotion, corrupting_rage
1:36.589 default E use_items Fluffy_Pillow 38.2/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, wafting_devotion, corrupting_rage
1:36.589 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:37.961 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:39.443 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:40.433 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, kindled_soul(85)
1:41.917 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:42.907 aoe R starfire Fluffy_Pillow 47.8/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:44.391 aoe O wrath Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:45.383 aoe K cancel_buff Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:45.383 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), dreamstate(2), undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:46.601 aoe O wrath Fluffy_Pillow 36.0/100: 36% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:47.356 aoe Q starfall Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, dreamstate, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:48.528 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage, kindled_soul(45)
1:49.546 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage, kindled_soul(40)
1:51.238 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage, kindled_soul(30)
1:52.367 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage, kindled_soul(25)
1:53.999 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), undulating_sporecloak, corrupting_rage, kindled_soul(15)
1:55.087 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
1:56.717 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:58.350 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:59.440 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:01.071 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:02.291 aoe O wrath Fluffy_Pillow 6.2/100: 6% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:03.374 aoe O wrath Fluffy_Pillow 18.2/100: 18% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:04.128 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:05.103 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:06.187 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:07.750 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:09.316 aoe L starfall Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:10.361 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:11.869 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:12.879 aoe P fury_of_elune Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:13.795 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:15.167 aoe K cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:15.167 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:16.192 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:17.178 aoe Q starfall Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:18.206 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:19.691 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:21.176 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:22.659 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:23.651 aoe O wrath Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
2:24.640 aoe L starfall Fluffy_Pillow 72.8/100: 73% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak
2:25.729 aoe O wrath Fluffy_Pillow 29.8/100: 30% astral_power primordial_arcanic_pulsar(25), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:26.484 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:27.464 aoe L starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:28.553 aoe R starfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:30.185 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:31.402 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.161 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:34.333 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:36.027 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:37.721 aoe Q starfall Fluffy_Pillow 64.8/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:38.851 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:40.483 aoe O wrath Fluffy_Pillow 39.0/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:41.573 aoe O wrath Fluffy_Pillow 49.0/100: 49% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:42.329 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:43.308 aoe K cancel_buff Fluffy_Pillow 84.2/100: 84% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:43.308 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:44.526 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:46.283 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:47.455 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:49.149 aoe Q starfall Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:50.278 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:51.763 aoe R starfire Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:53.247 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:54.237 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:55.721 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:56.710 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:58.193 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:58.193 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:59.301 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.367 default F natures_vigil 460 T31_4p 14.4/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.432 aoe O wrath Fluffy_Pillow 14.4/100: 14% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:01.458 aoe O wrath Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:02.211 aoe M starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:03.227 aoe Q starfall Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:04.357 aoe R starfire Fluffy_Pillow 20.6/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:05.990 aoe R starfire Fluffy_Pillow 47.8/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:07.623 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:08.713 aoe N incarnation_chosen_of_elune Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:08.713 default E use_items Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:08.713 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:09.605 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:10.596 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:11.486 aoe R starfire Fluffy_Pillow 75.4/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(90)
3:12.969 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
3:12.969 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
3:14.079 aoe P fury_of_elune Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(75)
3:15.144 aoe Q starfall Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(70)
3:16.210 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
3:17.238 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(60)
3:18.721 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(50)
3:20.204 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(45)
3:21.191 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(40)
3:22.672 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(35)
3:23.663 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(30)
3:25.146 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(20)
3:26.137 aoe K cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:26.137 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:27.247 aoe Q starfall Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:28.313 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:29.852 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:30.877 aoe R starfire Fluffy_Pillow 21.0/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:32.360 aoe R starfire Fluffy_Pillow 44.2/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:33.844 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:35.329 aoe R starfire Fluffy_Pillow 82.6/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:36.812 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:37.802 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:39.286 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:39.286 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:40.395 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:41.462 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:43.001 aoe Q starfall Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:44.028 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:45.513 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:46.995 aoe R starfire Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:48.477 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:49.467 aoe R starfire Fluffy_Pillow 47.0/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.837 aoe L starfall Fluffy_Pillow 61.0/100: 61% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.846 aoe O wrath Fluffy_Pillow 50.0/100: 50% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.600 aoe O wrath Fluffy_Pillow 62.0/100: 62% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.353 aoe K cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.353 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.480 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.105 aoe Q starfall Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:57.189 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.609 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.560 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.932 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:02.304 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:03.676 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:04.591 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:05.963 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:06.877 aoe K cancel_buff Fluffy_Pillow 46.2/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:06.877 aoe L starfall Fluffy_Pillow 46.2/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:07.901 aoe O wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:08.888 aoe O wrath Fluffy_Pillow 59.2/100: 59% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:09.642 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:10.727 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:11.669 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:12.715 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:14.224 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:15.732 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:17.365 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:18.455 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:20.087 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:21.718 aoe K cancel_buff Fluffy_Pillow 85.4/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:21.718 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:22.939 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:24.697 aoe O wrath Fluffy_Pillow 56.4/100: 56% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:25.453 aoe O wrath Fluffy_Pillow 68.4/100: 68% astral_power primordial_arcanic_pulsar(40), starfall, starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:26.208 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:27.381 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:29.074 aoe L starfall Fluffy_Pillow 98.6/100: 99% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak
4:30.203 default F natures_vigil 460 T31_4p 57.6/100: 58% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:30.432 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:32.065 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:33.156 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:34.788 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:36.421 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:36.421 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:37.641 aoe P fury_of_elune Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
4:38.627 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.613 default E use_items Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.613 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
4:40.563 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
4:41.512 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
4:42.882 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
4:44.254 aoe L starfall Fluffy_Pillow 97.8/100: 98% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
4:45.168 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
4:46.539 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
4:47.455 aoe L starfall Fluffy_Pillow 96.0/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
4:48.372 aoe O wrath Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
4:49.287 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
4:50.293 aoe O wrath Fluffy_Pillow 30.0/100: 30% astral_power primordial_arcanic_pulsar(30), starfall(4), starlord(3), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
4:51.048 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
4:51.953 aoe Q starfall Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
4:53.079 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(35)
4:54.703 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
4:55.788 aoe R starfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(20)
4:57.353 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(15)
4:58.918 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
4:59.962 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:01.471 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:02.980 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:04.489 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:05.496 aoe O wrath Fluffy_Pillow 36.4/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:06.504 default D potion Fluffy_Pillow 46.4/100: 46% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
5:06.504 aoe O wrath Fluffy_Pillow 46.4/100: 46% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35411 33725 30015
Intellect 2089 0 13505 12693 10000 (6103)
Spirit 0 0 0 0 0
Health 708220 674500 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13505 12693 0
Crit 27.22% 21.01% 2881
Haste 23.40% 23.40% 3770
Versatility 8.77% 3.77% 773
Mana Regen 2560 2560 0
Attack Power 14045 13201 0
Mastery 27.72% 27.72% 7041
Armor 4485 4485 4485
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 468.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 460, stats: { 499 Armor, +2103 Sta, +206 Haste, +487 Vers, +537 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 460, stats: { 409 Armor, +2103 Sta, +317 Haste, +376 Mastery, +537 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31_4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=460
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=460
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.50
# gear_stamina=30015
# gear_intellect=10000
# gear_crit_rating=2881
# gear_haste_rating=3770
# gear_mastery_rating=7041
# gear_versatility_rating=773
# gear_armor=4485
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

470 T31_2p : 718551 dps, 131201 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
718550.8 718550.8 357.8 / 0.050% 64402.5 / 9.0% 52518.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.7 13.8 Astral Power 0.00% 56.0 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31_2p 718551
Astral Smolder 102546 14.3% 375.4 0.85s 81642 0 Periodic 736.0 41641 0 41641 0.0% 81.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.38 0.00 735.99 735.99 288.27 0.0000 2.0000 30646667.02 30646667.02 0.00% 20819.92 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 735.99 548 941 41640.65 3454 210029 41702.62 35631 48719 30646667 30646667 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20962 2.9% 5.1 64.69s 1224260 1254979 Direct 756.3 5246 11114 8282 51.7%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 756.30 0.00 0.00 0.00 0.9756 0.0000 6263599.26 6263599.26 0.00% 1254978.81 1254978.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.26% 364.97 215 535 5245.74 2771 16626 5254.05 4558 6008 1914475 1914475 0.00%
crit 51.74% 391.32 262 573 11114.21 5542 33252 11121.02 9907 12830 4349124 4349124 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2995 0.4% 16.9 16.74s 53121 0 Direct 16.9 41753 83177 53124 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.90 16.90 0.00 0.00 0.00 0.0000 0.0000 897644.98 897644.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.56% 12.26 2 27 41753.21 27654 160477 41614.07 27895 95508 511988 511988 0.00%
crit 27.44% 4.64 0 19 83176.78 55309 320954 81987.06 0 296196 385657 385657 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2890 0.4% 33.8 8.77s 25578 0 Direct 33.7 20103 40176 25646 27.6%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.81 33.72 0.00 0.00 0.00 0.0000 0.0000 864872.12 864872.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.39% 24.41 10 46 20103.12 19574 22717 20102.98 19761 21043 490729 490729 0.00%
crit 27.61% 9.31 1 24 40176.23 39147 45434 40178.03 39147 44967 374143 374143 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 62449 8.7% 3.0 1.09s 6228660 6707100 Direct 6.0 6215 12422 9215 48.3%
Periodic 1804.8 7270 14746 10323 40.8% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1804.78 1804.78 0.00 0.9288 0.9872 18685979.98 18685979.98 0.00% 10471.37 6707099.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.68% 3.10 0 6 6215.33 6150 7016 6119.15 0 7016 19270 19270 0.00%
crit 48.32% 2.90 0 6 12421.82 12300 14032 12168.76 0 14032 36016 36016 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.16% 1067.74 782 1349 7270.35 5777 11655 7269.51 7041 7467 7762765 7762765 0.00%
crit 40.84% 737.03 517 945 14745.80 11553 23311 14746.53 14272 15179 10867929 10867929 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (62083) 0.0% (8.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 15360 2.1% 233.7 1.48s 19663 0 Direct 233.1 12655 26608 19713 50.6%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.74 233.14 0.00 0.00 0.00 0.0000 0.0000 4595828.44 4595828.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.41% 115.20 71 166 12654.82 9338 22875 12656.82 11924 13609 1457801 1457801 0.00%
crit 50.59% 117.94 73 177 26607.79 18676 45750 26621.99 24950 28961 3138028 3138028 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 15413 2.1% 235.3 1.48s 19596 0 Direct 234.7 12621 26534 19648 50.5%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.31 234.70 0.00 0.00 0.00 0.0000 0.0000 4611203.74 4611203.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.50% 116.17 73 169 12621.44 8650 22875 12622.65 11845 13532 1466168 1466168 0.00%
crit 50.50% 118.53 73 170 26533.51 17299 45750 26548.35 25027 28534 3145035 3145035 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 31310 4.4% 15.7 19.35s 598448 0 Direct 93.6 64376 135346 100060 50.3%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.65 93.63 0.00 0.00 0.00 0.0000 0.0000 9367505.68 9367505.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.73% 46.56 22 78 64376.31 35656 230979 64403.51 50274 79094 2997252 2997252 0.00%
crit 50.27% 47.07 21 79 135346.30 71313 461959 135377.37 107601 164843 6370254 6370254 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 233259 32.5% 103.9 2.86s 671459 658224 Direct 1766.3 26420 55966 39487 44.2%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.87 1766.26 0.00 0.00 0.00 1.0201 0.0000 69743456.34 69743456.34 0.00% 658224.15 658224.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.77% 985.12 706 1247 26420.23 6465 93756 26468.45 24147 29453 26026087 26026087 0.00%
crit 44.23% 781.14 571 1024 55966.30 12929 187318 56051.38 51697 61464 43717370 43717370 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.77
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.10
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 169112 23.5% 116.8 2.53s 432881 308019 Direct 706.9 45304 96089 71536 51.7%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.82 706.92 0.00 0.00 0.00 1.4054 0.0000 50569064.19 50569064.19 0.00% 308019.27 308019.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.35% 341.78 240 464 45303.98 6476 206115 45314.29 40549 51912 15483804 15483804 0.00%
crit 51.65% 365.14 268 478 96088.77 12952 409818 96124.26 85303 112711 35085260 35085260 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.36
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.99
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 53101 7.4% 1.0 0.00s 15879591 16965375 Direct 1.0 4890 9780 6248 27.8%
Periodic 1817.7 6235 12989 8733 37.0% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1817.73 1817.73 0.00 0.9365 0.9868 15879590.60 15879590.60 0.00% 8847.86 16965374.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.21% 0.72 0 1 4890.35 4862 4919 3531.15 0 4919 3531 3531 0.00%
crit 27.79% 0.28 0 1 9779.84 9724 9837 2718.20 0 9837 2718 2718 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.02% 1145.49 849 1449 6234.92 4774 10596 6236.48 6048 6448 7141934 7141934 0.00%
crit 36.98% 672.25 496 879 12988.59 9548 21192 12993.46 12556 13533 8731407 8731407 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5527) 0.0% (0.8%) 8.4 32.34s 198093 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.36 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2887 0.4% 8.4 32.34s 103456 0 Direct 50.1 13537 27050 17242 27.4%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.36 50.14 0.00 0.00 0.00 0.0000 0.0000 864569.95 864569.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.58% 36.39 6 85 13537.20 13177 15293 13537.13 13247 14497 492655 492655 0.00%
crit 27.42% 13.75 1 40 27050.12 26354 30586 27053.17 26354 29958 371915 371915 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2641 0.4% 16.1 15.74s 49256 0 Direct 96.3 6441 12872 8209 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.06 96.34 0.00 0.00 0.00 0.0000 0.0000 790880.69 790880.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.50% 69.85 14 165 6440.83 6270 7277 6440.67 6307 6899 449868 449868 0.00%
crit 27.50% 26.49 1 67 12871.51 12540 14554 12873.42 12582 13806 341013 341013 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3626 0.5% 26.2 10.45s 41618 53790 Direct 26.1 30096 59934 41851 39.4%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.21 26.07 0.00 0.00 0.00 0.7737 0.0000 1090905.78 1090905.78 0.00% 53789.55 53789.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.61% 15.80 5 28 30095.78 13246 56656 30031.01 20102 37284 475520 475520 0.00%
crit 39.39% 10.27 2 21 59933.93 26492 111555 59803.54 32076 84134 615386 615386 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.29
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.12s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 26.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.19 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.44s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 306.45s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.5 5.7 17.6s 13.5s 9.6s 55.81% 57.69% 5.7 (19.1) 16.9

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.2s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.3s
  • uptime_min/max:51.65% / 59.32%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.76%
  • balance_of_all_things_arcane_2:6.15%
  • balance_of_all_things_arcane_3:6.63%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.32%
  • balance_of_all_things_arcane_6:7.54%
  • balance_of_all_things_arcane_7:7.65%
  • balance_of_all_things_arcane_8:7.71%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.0s 29.9s 7.9s 27.02% 30.11% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.2s
  • trigger_min/max:4.1s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.56% / 29.99%

Stack Uptimes

  • balance_of_all_things_nature_1:3.34%
  • balance_of_all_things_nature_2:3.35%
  • balance_of_all_things_nature_3:3.37%
  • balance_of_all_things_nature_4:3.38%
  • balance_of_all_things_nature_5:3.38%
  • balance_of_all_things_nature_6:3.39%
  • balance_of_all_things_nature_7:3.40%
  • balance_of_all_things_nature_8:3.41%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.0s 70.0s 10.8s 10.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 339.5s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.54%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.2s 70.0s 45.5s 33.31% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 354.5s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 311.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.31%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 327.7s
  • trigger_min/max:12.0s / 327.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.27%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.3s 70.3s 44.9s 33.24% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 349.5s
  • trigger_min/max:12.0s / 327.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 289.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.24%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.2s 70.2s 10.8s 10.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 334.1s
  • trigger_min/max:12.0s / 334.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.55%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 70.2s 45.1s 33.44% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.8s / 348.3s
  • trigger_min/max:12.0s / 334.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.44%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.4s 50.0s 80.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 336.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.4s
  • uptime_min/max:51.80% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.15%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.2 0.1 20.5s 21.4s 2.2s 10.91% 20.59% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 54.5s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.31% / 15.06%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.54%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.8s 14.9s 21.2s 93.04% 93.73% 8.1 (8.1) 12.3

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 70.8s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.5s
  • uptime_min/max:90.27% / 95.86%

Stack Uptimes

  • eclipse_lunar_1:93.04%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.3s 38.3s 19.1s 52.48% 54.39% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.5s
  • trigger_min/max:12.0s / 84.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.89% / 59.82%

Stack Uptimes

  • eclipse_solar_1:52.48%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.0s 306.0s 27.3s 12.92% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.5s
  • trigger_min/max:300.0s / 325.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.8s 64.8s 7.9s 13.51% 0.00% 75.7 (75.7) 5.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 89.8s
  • trigger_min/max:60.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.45% / 15.68%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.3s 38.3s 19.1s 52.48% 55.10% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.5s
  • trigger_min/max:12.0s / 84.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.89% / 59.82%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.48%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.8s 90.8s 19.5s 23.99% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 123.7s
  • trigger_min/max:90.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.11% / 26.96%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.53% / 21.02%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.6s 70.0s 0.9s 0.76% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 338.6s
  • trigger_min/max:0.1s / 338.6s
  • trigger_pct:14.95%
  • duration_min/max:0.0s / 6.1s
  • uptime_min/max:0.00% / 5.35%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.7 34.2s 34.2s 30.0s 91.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.8s / 46.7s
  • trigger_min/max:20.8s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s
  • uptime_min/max:87.13% / 94.35%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.21%
  • primordial_arcanic_pulsar_10:6.70%
  • primordial_arcanic_pulsar_15:7.68%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.53%
  • primordial_arcanic_pulsar_30:8.25%
  • primordial_arcanic_pulsar_35:8.63%
  • primordial_arcanic_pulsar_40:9.06%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.89%
  • primordial_arcanic_pulsar_55:8.90%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.5 15.6s 13.5s 6.7s 43.90% 43.08% 3.5 (3.5) 19.3

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.8s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.04% / 47.01%

Stack Uptimes

  • solstice_1:43.90%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.9 0.0 143.0s 2.9s 295.7s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.5s
  • trigger_min/max:0.7s / 8.7s
  • trigger_pct:99.99%
  • duration_min/max:7.0s / 358.0s
  • uptime_min/max:98.42% / 99.49%

Stack Uptimes

  • starfall_1:5.42%
  • starfall_2:33.19%
  • starfall_3:42.17%
  • starfall_4:14.62%
  • starfall_5:3.13%
  • starfall_6:0.34%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.9 14.5s 2.9s 13.9s 97.55% 0.00% 41.6 (41.6) 5.9

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.8s
  • trigger_min/max:0.8s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.16% / 99.35%

Stack Uptimes

  • starlord_1:12.80%
  • starlord_2:17.82%
  • starlord_3:66.92%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.9 2.7 12.8s 11.4s 1.6s 12.40% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 51.5s
  • trigger_min/max:0.0s / 51.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:4.30% / 25.09%

Stack Uptimes

  • umbral_embrace_1:12.40%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.2 48.3 48.1s 5.5s 43.4s 90.24% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 315.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.7s
  • uptime_min/max:72.42% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.24%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.4s 45.6s 16.5s 23.61% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 207.9s
  • trigger_min/max:0.0s / 207.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.5s
  • uptime_min/max:4.23% / 58.47%

Stack Uptimes

  • wafting_devotion_1:23.61%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.4s 23.2s 47.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.54% 0.0s 0.0s 1.0s
Astral Smolder 74.07% 62.84% 83.23% 4.2s 0.0s 48.7s
Incarnation (Total) 52.48% 46.89% 59.82% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.17% 29.45% 34.89% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.56% 32.32% 46.97% 9.4s 0.0s 15.0s
No Eclipse 6.92% 4.14% 9.71% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.0480.00029.78225.8386.30381.114

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.21100.0%0.000.0%0.000.0%0.000.0%
Starfire2.302.0%0.000.0%49.7142.2%65.8155.9%
Starfall21.127.1%0.000.0%118.2840.0%156.2752.9%
Fury of Elune19.672.6%0.000.0%143.1118.9%593.5278.5%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31_2p
Fury of EluneAstral Power80.69241.755.83%3.000.330.14%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.65467.5711.28%29.872.020.43%
Shooting Stars (Moonfire)Astral Power233.74467.2111.27%2.000.260.06%
Shooting Stars (Sunfire)Astral Power235.30470.3411.35%2.000.260.06%
StarfireAstral Power117.822211.8353.36%18.7733.741.50%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.21262.126.32%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31_2p
StarfallAstral Power 104.274107.19100.00%39.3939.5416980.82
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 734600.0 3331.34 3858.11 2622047.1 576834.9 19697.2 734600.0
Astral Power 20.0 13.84 13.66 36.6 53.5 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31_2p Fight Length
Count 8268
Mean 299.49
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.8196
5th Percentile 245.71
95th Percentile 354.23
( 95th Percentile - 5th Percentile ) 108.52
Mean Distribution
Standard Deviation 0.3829
95.00% Confidence Interval ( 298.74 - 300.24 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 520
0.1% Error 51925
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1035
DPS
470 T31_2p Damage Per Second
Count 8268
Mean 718550.82
Minimum 667987.69
Maximum 785378.94
Spread ( max - min ) 117391.25
Range [ ( max - min ) / 2 * 100% ] 8.17%
Standard Deviation 16599.9302
5th Percentile 692708.86
95th Percentile 747208.42
( 95th Percentile - 5th Percentile ) 54499.56
Mean Distribution
Standard Deviation 182.5602
95.00% Confidence Interval ( 718193.01 - 718908.63 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2051
0.1 Scale Factor Error with Delta=300 2352319
0.05 Scale Factor Error with Delta=300 9409276
0.01 Scale Factor Error with Delta=300 235231887
Priority Target DPS
470 T31_2p Priority Target Damage Per Second
Count 8268
Mean 131201.22
Minimum 118727.88
Maximum 147390.19
Spread ( max - min ) 28662.32
Range [ ( max - min ) / 2 * 100% ] 10.92%
Standard Deviation 4026.3066
5th Percentile 124801.95
95th Percentile 138073.85
( 95th Percentile - 5th Percentile ) 13271.90
Mean Distribution
Standard Deviation 44.2799
95.00% Confidence Interval ( 131114.44 - 131288.01 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3618
0.1 Scale Factor Error with Delta=300 138388
0.05 Scale Factor Error with Delta=300 553551
0.01 Scale Factor Error with Delta=300 13838766
DPS(e)
470 T31_2p Damage Per Second (Effective)
Count 8268
Mean 718550.82
Minimum 667987.69
Maximum 785378.94
Spread ( max - min ) 117391.25
Range [ ( max - min ) / 2 * 100% ] 8.17%
Damage
470 T31_2p Damage
Count 8268
Mean 214871768.76
Minimum 166047566.31
Maximum 264656177.15
Spread ( max - min ) 98608610.83
Range [ ( max - min ) / 2 * 100% ] 22.95%
DTPS
470 T31_2p Damage Taken Per Second
Count 8268
Mean 3858.34
Minimum 821.37
Maximum 7572.32
Spread ( max - min ) 6750.95
Range [ ( max - min ) / 2 * 100% ] 87.49%
HPS
470 T31_2p Healing Per Second
Count 8268
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31_2p Healing Per Second (Effective)
Count 8268
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31_2p Heal
Count 8268
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31_2p Healing Taken Per Second
Count 8268
Mean 3324.36
Minimum 555.64
Maximum 6806.51
Spread ( max - min ) 6250.87
Range [ ( max - min ) / 2 * 100% ] 94.02%
TMI
470 T31_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.06 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.77 starfall,if=variable.starfall_condition1
M 1.36 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.29 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.10 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.99 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMLNDEPQRRLRLRLRLRKLLQRRRLRRLRLRLRKLLRQRRRLRLRRLRLOOQRQRRRLRKLQQRRPRLOLORKLQRRLRLRRLOOFQRRQREQRRLRKLQOORQRRLRRLRQROLOQRRRLRRLPQRLRLLRRLOORLQRRQRRLRLOORLRQRQRRLRLFRKLOOQRNQERRRLRLRPQQRQRLRLRLRKLQRQRRRRLLRKLQRQOORRLRRKLLQRRRLRLOOLRQRRPLRLRL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31_2p 0.0/100: 0% astral_power
Pre precombat 1 food 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31_2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31_2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.937 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.872 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.808 aoe J moonfire enemy4 65.2/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.745 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:04.681 aoe M starfire Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:05.492 aoe L starfall Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, undulating_sporecloak, corrupting_rage
0:06.392 aoe N incarnation_chosen_of_elune Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
0:06.392 default D potion Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage
0:06.392 default E use_items Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:06.392 aoe P fury_of_elune Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.182 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.971 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.724 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.477 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.240 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.381 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:12.142 aoe R starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.281 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:14.042 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.180 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.941 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.081 aoe K cancel_buff Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.081 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.933 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.754 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.543 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.684 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.824 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.963 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.725 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.864 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_urctos(11), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:26.004 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.765 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.904 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.665 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(7), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.805 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(6), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.567 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_urctos(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.707 aoe K cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.707 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), best_friends_with_urctos(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.558 aoe L starfall Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, best_friends_with_urctos(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.377 aoe R starfire Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), best_friends_with_urctos(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.558 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.348 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), best_friends_with_urctos, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:36.485 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:37.625 aoe R starfire Fluffy_Pillow 76.6/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:38.763 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:39.524 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
0:40.665 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
0:41.652 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:43.133 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
0:44.612 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
0:45.600 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), undulating_sporecloak, corrupting_rage
0:47.081 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), undulating_sporecloak, corrupting_rage
0:48.188 aoe O wrath Fluffy_Pillow 48.6/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, best_friends_with_urctos(11), undulating_sporecloak, corrupting_rage
0:49.252 aoe O wrath Fluffy_Pillow 60.6/100: 61% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_urctos(10), undulating_sporecloak, corrupting_rage
0:50.008 aoe Q starfall Fluffy_Pillow 70.6/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos(10), undulating_sporecloak, corrupting_rage
0:51.178 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_urctos(8), undulating_sporecloak, corrupting_rage
0:52.191 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_urctos(7), undulating_sporecloak, corrupting_rage
0:53.317 aoe R starfire Fluffy_Pillow 13.8/100: 14% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_urctos(6), undulating_sporecloak, corrupting_rage
0:54.945 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_urctos(5), undulating_sporecloak, corrupting_rage
0:56.573 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos(3), undulating_sporecloak, corrupting_rage
0:58.202 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_urctos, undulating_sporecloak, corrupting_rage
0:59.288 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:00.769 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), undulating_sporecloak, corrupting_rage
1:00.769 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, undulating_sporecloak, corrupting_rage
1:01.876 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, umbral_embrace, undulating_sporecloak, corrupting_rage
1:02.941 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), umbral_embrace, undulating_sporecloak, corrupting_rage
1:03.968 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), umbral_embrace, undulating_sporecloak, corrupting_rage
1:05.448 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), undulating_sporecloak, corrupting_rage
1:06.928 aoe P fury_of_elune Fluffy_Pillow 51.4/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos(11), undulating_sporecloak, corrupting_rage
1:07.918 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos(10), undulating_sporecloak, corrupting_rage
1:09.397 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos(9), undulating_sporecloak, corrupting_rage
1:10.385 aoe O wrath Fluffy_Pillow 59.6/100: 60% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(8), undulating_sporecloak, corrupting_rage
1:11.138 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall, starlord(3), dreamstate, best_friends_with_urctos(7), undulating_sporecloak, corrupting_rage
1:12.222 aoe O wrath Fluffy_Pillow 38.6/100: 39% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos(6), undulating_sporecloak, corrupting_rage
1:12.977 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos(5), undulating_sporecloak, corrupting_rage
1:14.603 aoe K cancel_buff Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos(3), undulating_sporecloak, corrupting_rage
1:14.603 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_urctos(3), undulating_sporecloak, corrupting_rage
1:15.820 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_urctos(2), corrupting_rage
1:16.991 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), best_friends_with_urctos, corrupting_rage
1:18.679 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), corrupting_rage
1:20.367 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), corrupting_rage
1:21.494 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), corrupting_rage
1:23.123 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), corrupting_rage
1:24.209 aoe R starfire Fluffy_Pillow 31.4/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), corrupting_rage
1:25.840 aoe R starfire Fluffy_Pillow 50.6/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:27.468 aoe L starfall Fluffy_Pillow 71.8/100: 72% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:28.555 aoe O wrath Fluffy_Pillow 26.8/100: 27% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:29.309 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage
1:30.064 default F natures_vigil 470 T31_2p 48.8/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), undulating_sporecloak, corrupting_rage
1:30.064 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), undulating_sporecloak, corrupting_rage
1:31.280 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, undulating_sporecloak, corrupting_rage
1:33.035 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, undulating_sporecloak, corrupting_rage
1:34.788 aoe Q starfall Fluffy_Pillow 66.2/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, undulating_sporecloak, corrupting_rage
1:35.959 aoe R starfire Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
1:37.495 default E use_items Fluffy_Pillow 52.4/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), undulating_sporecloak, corrupting_rage
1:37.495 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:38.520 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:40.001 aoe R starfire Fluffy_Pillow 82.6/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:41.480 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, kindled_soul(85)
1:42.469 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), umbral_embrace, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:43.950 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:43.950 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:45.056 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:46.121 aoe O wrath Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
1:47.068 aoe O wrath Fluffy_Pillow 34.2/100: 34% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
1:47.822 aoe R starfire Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
1:48.761 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
1:49.803 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
1:51.310 aoe R starfire Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
1:52.816 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
1:53.822 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
1:55.326 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
1:56.832 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
1:57.838 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), umbral_embrace, undulating_sporecloak, wafting_devotion, corrupting_rage
1:59.342 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), undulating_sporecloak, wafting_devotion, corrupting_rage
2:00.469 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, undulating_sporecloak, corrupting_rage
2:02.222 aoe O wrath Fluffy_Pillow 38.6/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, undulating_sporecloak, corrupting_rage
2:03.391 aoe L starfall Fluffy_Pillow 48.6/100: 49% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate(2), undulating_sporecloak, corrupting_rage
2:04.562 aoe O wrath Fluffy_Pillow 5.6/100: 6% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
2:05.316 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), dreamstate, corrupting_rage
2:06.443 aoe R starfire Fluffy_Pillow 6.6/100: 7% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), corrupting_rage
2:07.423 aoe R starfire Fluffy_Pillow 29.8/100: 30% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:09.050 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:10.679 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:11.764 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:13.394 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:15.024 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:16.239 aoe P fury_of_elune Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:17.303 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.368 aoe R starfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:19.904 aoe L starfall Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:20.929 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:22.409 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:23.398 aoe L starfall Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:24.387 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:25.868 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:27.350 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.436 aoe O wrath Fluffy_Pillow 40.2/100: 40% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.191 aoe O wrath Fluffy_Pillow 52.2/100: 52% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:29.946 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:31.451 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:32.576 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:33.657 aoe R starfire Fluffy_Pillow 11.4/100: 11% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:35.219 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:36.780 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.823 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:39.330 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:40.836 aoe L starfall Fluffy_Pillow 65.2/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:41.842 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.347 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.351 aoe O wrath Fluffy_Pillow 32.4/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:45.437 aoe O wrath Fluffy_Pillow 44.4/100: 44% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.191 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.169 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.386 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.140 aoe Q starfall Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.310 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.847 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.871 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.352 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.834 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.824 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:59.306 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.295 default F natures_vigil 470 T31_2p 62.6/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.295 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.775 aoe K cancel_buff Fluffy_Pillow 81.8/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.775 aoe L starfall Fluffy_Pillow 81.8/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:02.883 aoe O wrath Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:03.638 aoe O wrath Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak
3:04.392 aoe Q starfall Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, undulating_sporecloak
3:05.563 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static
3:07.251 aoe N incarnation_chosen_of_elune Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static
3:07.251 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), dreamstate(2), best_friends_with_aerwynn_static
3:08.275 default E use_items Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_aerwynn_static
3:08.275 aoe R starfire Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, kindled_soul(100)
3:09.163 aoe R starfire Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, kindled_soul(100)
3:10.051 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(95)
3:11.533 aoe L starfall Fluffy_Pillow 97.6/100: 98% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(85)
3:12.521 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(80)
3:14.002 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(75)
3:14.992 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(70)
3:16.472 aoe P fury_of_elune Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(60)
3:17.460 aoe Q starfall Fluffy_Pillow 81.0/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:18.566 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:19.629 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:21.164 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:22.188 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:23.667 aoe L starfall Fluffy_Pillow 61.4/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:24.653 aoe R starfire Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(20)
3:26.134 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(15)
3:27.122 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(10)
3:28.492 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:29.407 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:30.775 aoe K cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:30.775 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:31.797 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:32.782 aoe R starfire Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:34.200 aoe Q starfall Fluffy_Pillow 43.2/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:35.147 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:36.517 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:37.887 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:39.258 aoe R starfire Fluffy_Pillow 77.8/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:40.629 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:41.543 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:42.459 aoe R starfire Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:43.941 aoe K cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:43.941 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_urctos_static, corrupting_rage
3:45.046 aoe Q starfall Fluffy_Pillow 52.2/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.110 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:47.646 aoe Q starfall Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.670 aoe O wrath Fluffy_Pillow 9.4/100: 9% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:49.658 aoe O wrath Fluffy_Pillow 21.4/100: 21% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:50.411 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:51.388 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.016 aoe L starfall Fluffy_Pillow 81.8/100: 82% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:54.102 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.731 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:57.360 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:57.360 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:58.576 aoe L starfall Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:59.642 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:00.668 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:02.148 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:03.627 aoe R starfire Fluffy_Pillow 74.6/100: 75% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:05.106 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:06.095 aoe R starfire Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:07.574 aoe L starfall Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:08.561 aoe O wrath Fluffy_Pillow 51.0/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:09.549 aoe O wrath Fluffy_Pillow 61.0/100: 61% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:10.303 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:11.390 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:12.370 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:13.586 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:15.340 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:17.092 aoe P fury_of_elune Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:18.263 aoe L starfall Fluffy_Pillow 74.6/100: 75% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:19.436 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:20.999 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:22.041 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:23.547 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 36730 34981 31271
Intellect 2089 0 13776 12951 10246 (6349)
Spirit 0 0 0 0 0
Health 734600 734600 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13776 12951 0
Crit 27.36% 21.15% 2907
Haste 23.68% 23.68% 3817
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14327 13469 0
Mastery 27.84% 27.84% 7080
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31271
# gear_intellect=10246
# gear_crit_rating=2907
# gear_haste_rating=3817
# gear_mastery_rating=7080
# gear_versatility_rating=793
# gear_armor=4652
# set_bonus=tier31_2pc=1

470 T31_4p : 779499 dps, 141937 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
779499.4 779499.4 388.5 / 0.050% 74224.4 / 9.5% 56977.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.7 13.8 Astral Power 0.00% 56.0 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31_4p 779499
Astral Smolder 117236 15.0% 375.2 0.85s 93412 0 Periodic 736.0 47621 0 47621 0.0% 81.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.20 0.00 735.98 735.98 288.13 0.0000 2.0000 35047713.51 35047713.51 0.00% 23810.28 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 735.98 548 931 47621.43 3972 219952 47688.24 40049 57723 35047714 35047714 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 23104 3.0% 5.1 64.71s 1350156 1384827 Direct 756.9 5825 12204 9127 51.8%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 756.89 0.00 0.00 0.00 0.9750 0.0000 6907515.51 6907515.51 0.00% 1384826.69 1384826.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.24% 365.13 214 540 5824.98 2771 18722 5834.51 5089 6768 2126727 2126727 0.00%
crit 51.76% 391.76 268 564 12203.77 5542 37443 12210.81 10930 13844 4780788 4780788 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3004 0.4% 17.0 16.82s 53098 0 Direct 17.0 41740 82892 53099 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 0.00 0.00 0.00 0.0000 0.0000 900331.52 900331.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.40% 12.28 1 27 41740.13 27654 160477 41585.26 27815 96648 512494 512494 0.00%
crit 27.60% 4.68 0 16 82892.45 55309 320954 81502.77 0 291239 387838 387838 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2895 0.4% 33.9 8.69s 25541 0 Direct 33.8 20103 40178 25610 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.94 33.84 0.00 0.00 0.00 0.0000 0.0000 866769.28 866769.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.57% 24.56 8 46 20102.55 19574 22717 20102.26 19792 20836 493711 493711 0.00%
crit 27.43% 9.29 0 24 40178.04 39147 45434 40160.79 0 42631 373058 373058 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 65947 8.5% 3.0 1.09s 6579079 7086979 Direct 6.0 6232 12452 9239 48.3%
Periodic 1805.4 7684 15562 10902 40.8% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1805.39 1805.39 0.00 0.9286 0.9872 19737235.66 19737235.66 0.00% 11057.08 7086978.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.66% 3.10 0 6 6231.75 6150 7138 6153.91 0 7138 19315 19315 0.00%
crit 48.34% 2.90 0 6 12452.03 12300 14276 12210.68 0 14276 36118 36118 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.15% 1067.95 788 1354 7684.01 5777 12075 7683.92 7480 7889 8206090 8206090 0.00%
crit 40.85% 737.44 545 953 15561.90 11553 24149 15564.10 15125 16139 11475713 11475713 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (67351) 0.0% (8.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 16642 2.1% 233.5 1.48s 21323 0 Direct 232.9 13704 28882 21379 50.6%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.55 232.93 0.00 0.00 0.00 0.0000 0.0000 4979787.91 4979787.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.44% 115.16 64 167 13704.48 9338 25404 13710.67 12685 14868 1578147 1578147 0.00%
crit 50.56% 117.78 68 169 28881.76 18676 50807 28903.61 27088 31734 3401641 3401641 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 16717 2.1% 235.4 1.48s 21250 0 Direct 234.8 13665 28791 21305 50.5%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.37 234.76 0.00 0.00 0.00 0.0000 0.0000 5001471.88 5001471.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.49% 116.18 66 170 13665.05 8650 25758 13670.42 12688 14799 1587649 1587649 0.00%
crit 50.51% 118.57 69 172 28791.35 17299 50807 28811.58 26866 31643 3413823 3413823 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 33992 4.4% 15.6 19.42s 650794 0 Direct 93.5 69673 147311 108787 50.4%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.63 93.50 0.00 0.00 0.00 0.0000 0.0000 10171065.38 10171065.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.62% 46.39 21 77 69673.23 35656 252411 69716.97 51961 89355 3232100 3232100 0.00%
crit 50.38% 47.10 22 77 147311.30 71313 498907 147440.64 111976 190382 6938965 6938965 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 257948 33.1% 103.9 2.87s 742504 727865 Direct 1766.8 29209 61870 43652 44.2%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.87 1766.85 0.00 0.00 0.00 1.0201 0.0000 77125984.07 77125984.07 0.00% 727864.56 727864.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.78% 985.51 707 1266 29208.78 6577 110592 29274.62 26510 32769 28785666 28785666 0.00%
crit 44.22% 781.34 575 1027 61869.81 13154 221183 61980.12 56923 68278 48340318 48340318 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.82
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.05
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 177622 22.8% 116.9 2.53s 454556 323445 Direct 707.2 47689 100838 75118 51.6%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.87 707.21 0.00 0.00 0.00 1.4054 0.0000 53122973.50 53122973.50 0.00% 323445.26 323445.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.39% 342.24 235 464 47688.88 6476 210125 47708.03 42351 54536 16320810 16320810 0.00%
crit 51.61% 364.97 264 481 100838.12 12952 417791 100882.83 89598 116329 36802163 36802163 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.35
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:116.07
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 55250 7.1% 1.0 0.00s 16523534 17653348 Direct 1.0 4890 9778 6235 27.5%
Periodic 1818.4 6461 13546 9084 37.0% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1818.38 1818.38 0.00 0.9365 0.9868 16523534.08 16523534.08 0.00% 9203.70 17653348.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.45% 0.72 0 1 4890.01 4862 4919 3543.05 0 4919 3543 3543 0.00%
crit 27.55% 0.28 0 1 9778.01 9724 9837 2693.35 0 9837 2693 2693 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.99% 1145.34 839 1454 6461.45 4774 10977 6464.67 6274 6712 7400545 7400545 0.00%
crit 37.01% 673.04 491 861 13545.98 9548 21954 13553.61 13031 14162 9116753 9116753 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5519) 0.0% (0.7%) 8.3 33.31s 198170 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.34 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2883 0.4% 8.3 33.31s 103519 0 Direct 50.0 13535 27052 17252 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.34 50.02 0.00 0.00 0.00 0.0000 0.0000 862973.97 862973.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.49% 36.26 6 86 13535.41 13177 15293 13534.98 13242 14429 490796 490796 0.00%
crit 27.51% 13.76 0 40 27052.38 26354 30586 27052.19 0 30586 372178 372178 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2636 0.3% 16.0 16.19s 49248 0 Direct 96.1 6441 12872 8208 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.02 96.13 0.00 0.00 0.00 0.0000 0.0000 789045.38 789045.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.52% 69.71 15 170 6440.70 6270 7277 6440.73 6297 7038 449000 449000 0.00%
crit 27.48% 26.42 2 66 12871.63 12540 14554 12874.43 12595 14255 340046 340046 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3625 0.5% 26.2 10.43s 41616 53790 Direct 26.1 30065 59980 41838 39.4%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.22 26.08 0.00 0.00 0.00 0.7737 0.0000 1091085.43 1091085.43 0.00% 53790.45 53790.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.65% 15.82 5 29 30065.43 13246 56074 30004.69 21201 37436 475516 475516 0.00%
crit 39.35% 10.26 1 22 59979.73 26492 111555 59878.56 26492 83861 615570 615570 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.29
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31_4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.96s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 135.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.45s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.5 5.7 17.6s 13.5s 9.6s 55.82% 57.70% 5.7 (19.0) 16.9

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.3s
  • trigger_min/max:0.0s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:51.53% / 59.00%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.76%
  • balance_of_all_things_arcane_2:6.16%
  • balance_of_all_things_arcane_3:6.64%
  • balance_of_all_things_arcane_4:7.05%
  • balance_of_all_things_arcane_5:7.32%
  • balance_of_all_things_arcane_6:7.53%
  • balance_of_all_things_arcane_7:7.65%
  • balance_of_all_things_arcane_8:7.71%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.0s 29.9s 7.9s 27.00% 30.10% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.1s
  • trigger_min/max:4.6s / 48.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.45% / 29.99%

Stack Uptimes

  • balance_of_all_things_nature_1:3.34%
  • balance_of_all_things_nature_2:3.35%
  • balance_of_all_things_nature_3:3.36%
  • balance_of_all_things_nature_4:3.37%
  • balance_of_all_things_nature_5:3.38%
  • balance_of_all_things_nature_6:3.39%
  • balance_of_all_things_nature_7:3.40%
  • balance_of_all_things_nature_8:3.41%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.0 85.7 20.5s 3.0s 17.7s 88.27% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.4s
  • trigger_min/max:0.8s / 13.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.94% / 93.05%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.17%
  • balance_t31_4pc_buff_lunar_2:13.76%
  • balance_t31_4pc_buff_lunar_3:14.08%
  • balance_t31_4pc_buff_lunar_4:11.65%
  • balance_t31_4pc_buff_lunar_5:35.60%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 56.3 38.2s 4.5s 18.8s 51.71% 0.00% 25.9 (25.9) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 83.4s
  • trigger_min/max:0.8s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:45.82% / 59.27%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.55%
  • balance_t31_4pc_buff_solar_2:6.44%
  • balance_t31_4pc_buff_solar_3:6.32%
  • balance_t31_4pc_buff_solar_4:6.52%
  • balance_t31_4pc_buff_solar_5:24.88%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.2s 69.2s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 335.8s
  • trigger_min/max:12.0s / 335.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.61%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.5s 69.2s 44.6s 33.22% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.3s / 351.8s
  • trigger_min/max:12.0s / 335.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.22%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.3s 69.3s 10.8s 10.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 333.1s
  • trigger_min/max:12.0s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.25%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.94%
  • best_friends_with_pip_10:0.95%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 111.7s 69.3s 44.9s 33.40% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.4s / 356.5s
  • trigger_min/max:12.0s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 331.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.40%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.6s 69.6s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 337.3s
  • trigger_min/max:12.0s / 337.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.41%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 111.9s 69.6s 45.0s 33.38% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 348.0s
  • trigger_min/max:12.0s / 337.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.38%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.5s 58.9s 50.6s 80.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 340.0s
  • trigger_min/max:15.0s / 306.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.1s
  • uptime_min/max:47.14% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.38%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.2 0.1 20.5s 21.4s 2.2s 10.90% 20.57% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.4s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.56% / 15.81%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.54%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.0 23.8s 14.9s 21.2s 93.06% 93.75% 8.0 (8.0) 12.3

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 70.8s
  • trigger_min/max:0.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.15% / 96.06%

Stack Uptimes

  • eclipse_lunar_1:93.06%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.3s 38.3s 19.1s 52.45% 54.36% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.9s
  • trigger_min/max:12.0s / 83.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.68% / 59.66%

Stack Uptimes

  • eclipse_solar_1:52.45%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.9s 305.9s 27.3s 12.93% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.84%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.9s 64.9s 7.9s 13.51% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.4s
  • trigger_min/max:60.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.74% / 15.56%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.3s 38.3s 19.1s 52.45% 55.07% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.9s
  • trigger_min/max:12.0s / 83.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.68% / 59.66%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.45%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.8s 90.8s 19.5s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 122.7s
  • trigger_min/max:90.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.48% / 26.98%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.3s 68.7s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 324.9s
  • trigger_min/max:0.0s / 324.9s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.00% / 5.61%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.7 34.2s 34.2s 30.1s 91.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 48.7s
  • trigger_min/max:21.0s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.4s
  • uptime_min/max:87.36% / 94.56%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.21%
  • primordial_arcanic_pulsar_10:6.71%
  • primordial_arcanic_pulsar_15:7.66%
  • primordial_arcanic_pulsar_20:8.32%
  • primordial_arcanic_pulsar_25:8.53%
  • primordial_arcanic_pulsar_30:8.25%
  • primordial_arcanic_pulsar_35:8.67%
  • primordial_arcanic_pulsar_40:9.08%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.88%
  • primordial_arcanic_pulsar_55:8.91%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.5 15.6s 13.5s 6.7s 43.90% 43.07% 3.5 (3.5) 19.3

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.2s
  • trigger_min/max:0.0s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.49% / 47.20%

Stack Uptimes

  • solstice_1:43.90%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.9 0.0 143.0s 2.9s 295.6s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.3s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:2.1s / 358.1s
  • uptime_min/max:98.38% / 99.49%

Stack Uptimes

  • starfall_1:5.45%
  • starfall_2:33.22%
  • starfall_3:42.11%
  • starfall_4:14.62%
  • starfall_5:3.14%
  • starfall_6:0.34%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.9 14.5s 2.9s 13.9s 97.54% 0.00% 41.6 (41.6) 5.9

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.53% / 99.35%

Stack Uptimes

  • starlord_1:12.77%
  • starlord_2:17.83%
  • starlord_3:66.93%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.8s 11.5s 1.6s 12.32% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 54.7s
  • trigger_min/max:0.0s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.06% / 24.01%

Stack Uptimes

  • umbral_embrace_1:12.32%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.2 47.7s 5.5s 43.1s 90.16% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 330.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.3s
  • uptime_min/max:73.87% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.16%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 252.1s
  • trigger_min/max:0.0s / 221.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 88.3s
  • uptime_min/max:4.45% / 67.27%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.4s 23.5s 48.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.74% 0.0s 0.0s 1.0s
Astral Smolder 74.03% 63.16% 85.91% 4.2s 0.0s 48.3s
Incarnation (Total) 52.45% 46.68% 59.66% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.15% 29.21% 34.86% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.61% 33.18% 47.09% 9.4s 0.0s 15.0s
No Eclipse 6.90% 3.94% 9.85% 1.7s 0.0s 4.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.0800.00028.40725.9916.09177.382

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.22100.0%0.000.0%0.000.0%0.000.0%
Starfire2.281.9%0.000.0%49.8042.2%65.7955.8%
Starfall21.077.1%0.000.0%118.4740.1%156.2352.8%
Fury of Elune19.512.6%0.000.0%143.1818.9%594.2178.5%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31_4p
Fury of EluneAstral Power80.72241.835.83%3.000.330.14%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.63466.8411.26%29.872.000.43%
Shooting Stars (Moonfire)Astral Power233.54466.8311.26%2.000.260.06%
Shooting Stars (Sunfire)Astral Power235.36470.4711.35%2.000.250.05%
StarfireAstral Power117.872213.1453.39%18.7833.541.49%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.22262.166.32%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31_4p
StarfallAstral Power 104.234105.73100.00%39.3939.5318784.95
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 734600.0 3321.95 3840.84 2932469.3 579146.9 -40053.4 734600.0
Astral Power 20.0 13.84 13.66 36.4 53.7 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31_4p Fight Length
Count 9243
Mean 299.59
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.7001
5th Percentile 245.42
95th Percentile 353.61
( 95th Percentile - 5th Percentile ) 108.19
Mean Distribution
Standard Deviation 0.3609
95.00% Confidence Interval ( 298.88 - 300.30 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 516
0.1% Error 51535
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1028
DPS
470 T31_4p Damage Per Second
Count 9243
Mean 779499.39
Minimum 718323.47
Maximum 853148.10
Spread ( max - min ) 134824.63
Range [ ( max - min ) / 2 * 100% ] 8.65%
Standard Deviation 19058.8740
5th Percentile 749667.98
95th Percentile 812489.85
( 95th Percentile - 5th Percentile ) 62821.87
Mean Distribution
Standard Deviation 198.2398
95.00% Confidence Interval ( 779110.85 - 779887.93 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2297
0.1 Scale Factor Error with Delta=300 3100832
0.05 Scale Factor Error with Delta=300 12403326
0.01 Scale Factor Error with Delta=300 310083134
Priority Target DPS
470 T31_4p Priority Target Damage Per Second
Count 9243
Mean 141937.28
Minimum 126726.45
Maximum 163035.48
Spread ( max - min ) 36309.02
Range [ ( max - min ) / 2 * 100% ] 12.79%
Standard Deviation 4542.5999
5th Percentile 134741.04
95th Percentile 149508.37
( 95th Percentile - 5th Percentile ) 14767.33
Mean Distribution
Standard Deviation 47.2496
95.00% Confidence Interval ( 141844.67 - 142029.88 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3935
0.1 Scale Factor Error with Delta=300 176155
0.05 Scale Factor Error with Delta=300 704617
0.01 Scale Factor Error with Delta=300 17615406
DPS(e)
470 T31_4p Damage Per Second (Effective)
Count 9243
Mean 779499.39
Minimum 718323.47
Maximum 853148.10
Spread ( max - min ) 134824.63
Range [ ( max - min ) / 2 * 100% ] 8.65%
Damage
470 T31_4p Damage
Count 9243
Mean 233127487.08
Minimum 181942597.51
Maximum 285845823.99
Spread ( max - min ) 103903226.48
Range [ ( max - min ) / 2 * 100% ] 22.28%
DTPS
470 T31_4p Damage Taken Per Second
Count 9243
Mean 3840.51
Minimum 1034.65
Maximum 7297.37
Spread ( max - min ) 6262.72
Range [ ( max - min ) / 2 * 100% ] 81.54%
HPS
470 T31_4p Healing Per Second
Count 9243
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31_4p Healing Per Second (Effective)
Count 9243
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31_4p Heal
Count 9243
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31_4p Healing Taken Per Second
Count 9243
Mean 3314.49
Minimum 563.13
Maximum 7016.92
Spread ( max - min ) 6453.78
Range [ ( max - min ) / 2 * 100% ] 97.36%
TMI
470 T31_4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31_4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31_4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.07 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.82 starfall,if=variable.starfall_condition1
M 1.35 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.29 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.05 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 116.07 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQQRLRLRLRLRLRRKLQRQRLRRLRLRLRRKLQRLRRLRLRRLRKLOOQRQRRLRLRKLQROOQRPRLRLRLLROOLRRLRLRRFLLQRRELOORLRLRQRLRQROORLRRKLRQRLPRLRLLROLOQRRQRRRLRRLOLOQRRRLRRKLLQRRLOORLRLRFQRRNQEPLRRLRLRKLQQRRRRLRLRRLQRQRRRLRLRKLQOORQRRLLRRKLQOOQRRRLRRKLQRRLOORLRRKLRQPFRQRLRELLROLORQRQRRRLRRLOOQRRLRLRRKLQRQRRODOLRLRKLRQRRQROORLRPLRLRRL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31_4p 0.0/100: 0% astral_power
Pre precombat 1 food 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31_4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31_4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.935 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.872 aoe J moonfire enemy3 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:02.810 aoe J moonfire enemy4 69.2/100: 69% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:03.746 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:04.682 aoe M starfire Fluffy_Pillow 38.2/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:05.493 aoe N incarnation_chosen_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, undulating_sporecloak, corrupting_rage
0:05.493 default D potion Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage
0:05.493 default E use_items Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:05.493 aoe P fury_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.312 aoe Q starfall Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.132 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.922 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.676 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.437 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.190 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.945 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.000 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.755 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.809 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.564 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.619 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.375 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.429 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.485 aoe K cancel_buff Fluffy_Pillow 92.8/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.485 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.274 aoe Q starfall Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.033 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.126 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.879 aoe R starfire Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.932 aoe L starfall Fluffy_Pillow 42.2/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.686 aoe R starfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.741 aoe R starfire Fluffy_Pillow 74.4/100: 74% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.880 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.641 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.779 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.542 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.681 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.442 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.205 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.344 aoe K cancel_buff Fluffy_Pillow 99.8/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.344 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.196 aoe Q starfall Fluffy_Pillow 64.8/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:34.015 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:35.196 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:35.951 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:37.006 aoe R starfire Fluffy_Pillow 75.2/100: 75% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:38.060 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:38.815 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:39.870 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:40.625 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:41.995 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:43.365 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:44.280 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:45.649 aoe K cancel_buff Fluffy_Pillow 80.2/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:45.649 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:46.672 aoe O wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:47.659 aoe O wrath Fluffy_Pillow 57.2/100: 57% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord, dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:48.414 aoe Q starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:49.495 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:50.434 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:51.478 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:52.848 aoe R starfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:54.219 aoe L starfall Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:55.130 aoe R starfire Fluffy_Pillow 71.8/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:56.498 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:57.412 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.782 aoe K cancel_buff Fluffy_Pillow 87.2/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.782 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:59.805 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:00.790 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.209 aoe O wrath Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:03.158 aoe O wrath Fluffy_Pillow 54.4/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:03.912 aoe Q starfall Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:05.040 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:06.018 aoe P fury_of_elune Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:07.105 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:08.733 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:09.820 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:11.448 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:12.535 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:14.163 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:15.381 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:16.552 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:18.240 aoe O wrath Fluffy_Pillow 59.4/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:19.366 aoe O wrath Fluffy_Pillow 69.4/100: 69% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:20.120 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static
1:21.247 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
1:22.225 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
1:23.855 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
1:24.942 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
1:26.569 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
1:27.655 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:29.136 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:30.615 default F natures_vigil 470 T31_4p 88.4/100: 88% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:30.615 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:31.721 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
1:32.786 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
1:33.812 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
1:35.292 aoe R starfire Fluffy_Pillow 46.6/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.772 default E use_items Fluffy_Pillow 73.8/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.772 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:37.759 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:38.747 aoe O wrath Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:39.501 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:40.479 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(85)
1:41.566 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
1:43.195 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
1:44.282 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
1:45.912 aoe Q starfall Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
1:47.039 aoe R starfire Fluffy_Pillow 21.4/100: 21% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
1:48.660 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
1:49.742 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
1:51.304 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
1:52.346 aoe R starfire Fluffy_Pillow 3.8/100: 4% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
1:53.852 aoe O wrath Fluffy_Pillow 25.0/100: 25% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
1:54.857 aoe O wrath Fluffy_Pillow 37.0/100: 37% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
1:55.611 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
1:56.516 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
1:57.523 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:59.027 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:00.531 aoe K cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:00.531 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:01.749 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:03.502 aoe Q starfall Fluffy_Pillow 65.8/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:04.672 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:06.208 aoe L starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:07.233 aoe P fury_of_elune Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:08.222 aoe R starfire Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:09.704 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:10.692 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:12.173 aoe L starfall Fluffy_Pillow 99.4/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:13.161 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:14.150 aoe R starfire Fluffy_Pillow 45.4/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:15.630 aoe O wrath Fluffy_Pillow 68.4/100: 68% astral_power primordial_arcanic_pulsar(20), starfall(3), umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:16.385 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power primordial_arcanic_pulsar(20), starfall(3), umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:17.510 aoe O wrath Fluffy_Pillow 37.4/100: 37% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord, umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:18.265 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:19.349 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:20.912 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:22.473 aoe Q starfall Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:23.516 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:25.021 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:26.526 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:28.035 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:29.040 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:30.546 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:32.051 aoe L starfall Fluffy_Pillow 80.8/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.267 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:34.022 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:35.194 aoe O wrath Fluffy_Pillow 34.8/100: 35% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:35.948 aoe Q starfall Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:37.075 aoe R starfire Fluffy_Pillow 5.8/100: 6% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:38.705 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:40.331 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:41.959 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:43.046 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:44.527 aoe R starfire Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.008 aoe K cancel_buff Fluffy_Pillow 98.8/100: 99% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.008 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.115 aoe L starfall Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.179 aoe Q starfall Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:49.205 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.685 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.165 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.153 aoe O wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.143 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.895 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.874 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.959 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.588 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:59.672 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.300 default F natures_vigil 470 T31_4p 66.8/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:01.300 aoe Q starfall Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:02.516 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:04.270 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:06.024 aoe N incarnation_chosen_of_elune Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:06.024 aoe Q starfall Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:07.089 default E use_items Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:07.089 aoe P fury_of_elune Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(100)
3:08.256 aoe L starfall Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(95)
3:09.281 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(90)
3:10.170 aoe R starfire Fluffy_Pillow 76.4/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(85)
3:11.059 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(85)
3:12.046 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(80)
3:13.525 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(70)
3:14.515 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
3:15.998 aoe K cancel_buff Fluffy_Pillow 98.2/100: 98% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:15.998 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:17.102 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:18.167 aoe Q starfall Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:19.190 aoe R starfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:20.177 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:21.657 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:23.138 aoe R starfire Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:24.619 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:25.608 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:27.087 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:28.075 aoe R starfire Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:29.555 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:31.035 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:32.141 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:33.206 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:34.742 aoe Q starfall Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:35.765 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:37.245 aoe R starfire Fluffy_Pillow 31.0/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:38.724 aoe R starfire Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:40.204 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:41.192 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
3:42.673 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
3:43.662 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
3:45.141 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static
3:45.141 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static
3:46.247 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static
3:47.310 aoe O wrath Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static
3:48.332 aoe O wrath Fluffy_Pillow 30.4/100: 30% astral_power primordial_arcanic_pulsar(55), starfall(3), starlord(2), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static
3:49.087 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_pip(3), best_friends_with_pip_static
3:50.102 aoe Q starfall Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
3:51.229 aoe R starfire Fluffy_Pillow 26.6/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
3:52.711 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:54.192 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:55.181 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:56.171 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:57.651 aoe R starfire Fluffy_Pillow 78.2/100: 78% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak
3:59.131 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak
3:59.131 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak
4:00.238 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak
4:01.302 aoe O wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:02.327 aoe O wrath Fluffy_Pillow 44.0/100: 44% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak
4:03.080 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak
4:04.207 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak
4:05.186 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:06.813 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:08.442 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:09.528 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:11.156 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak
4:12.785 aoe K cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:12.785 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:14.002 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:15.174 aoe R starfire Fluffy_Pillow 6.0/100: 6% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:16.864 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:18.552 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:19.679 aoe O wrath Fluffy_Pillow 28.2/100: 28% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:20.432 aoe O wrath Fluffy_Pillow 38.2/100: 38% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:21.187 aoe R starfire Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:22.691 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:23.697 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.201 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:26.708 aoe K cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:26.708 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:27.834 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:29.455 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:30.537 aoe P fury_of_elune Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.484 default F natures_vigil 470 T31_4p 33.0/100: 33% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.484 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.903 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:33.850 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:35.219 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.133 aoe R starfire Fluffy_Pillow 81.4/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.503 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.503 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
4:38.417 aoe L starfall Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
4:39.407 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
4:40.886 aoe O wrath Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
4:41.875 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), umbral_embrace, dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
4:43.092 aoe O wrath Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
4:43.849 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
4:44.903 aoe Q starfall Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
4:46.074 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
4:47.763 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
4:48.891 aoe R starfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
4:50.519 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
4:52.147 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
4:53.776 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
4:54.863 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
4:56.491 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
4:58.120 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:59.337 aoe O wrath Fluffy_Pillow 27.6/100: 28% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:00.090 aoe O wrath Fluffy_Pillow 41.6/100: 42% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:00.846 aoe Q starfall Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:02.017 aoe R starfire Fluffy_Pillow 12.6/100: 13% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:03.706 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:05.395 aoe L starfall Fluffy_Pillow 95.0/100: 95% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:06.523 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:08.153 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:09.239 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:10.721 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:12.201 aoe K cancel_buff Fluffy_Pillow 86.6/100: 87% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:12.201 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:13.310 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:14.374 aoe R starfire Fluffy_Pillow 26.6/100: 27% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:15.911 aoe Q starfall Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:16.936 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:18.416 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:19.895 aoe O wrath Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:20.882 default D potion Fluffy_Pillow 71.2/100: 71% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:20.882 aoe O wrath Fluffy_Pillow 71.2/100: 71% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:21.637 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall, starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:22.723 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:23.701 aoe L starfall Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:24.786 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:26.413 aoe K cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:26.413 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:27.628 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:29.385 aoe Q starfall Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:30.557 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:32.247 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:33.809 aoe Q starfall Fluffy_Pillow 61.2/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:34.853 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:36.360 aoe O wrath Fluffy_Pillow 37.4/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:37.364 aoe O wrath Fluffy_Pillow 47.4/100: 47% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:38.119 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:39.023 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:40.028 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:41.533 aoe P fury_of_elune Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:42.659 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:43.784 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:45.406 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:46.489 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:48.051 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:49.612 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 36730 34981 31271
Intellect 2089 0 13776 12951 10246 (6349)
Spirit 0 0 0 0 0
Health 734600 734600 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13776 12951 0
Crit 27.36% 21.15% 2907
Haste 23.68% 23.68% 3817
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14327 13469 0
Mastery 27.84% 27.84% 7080
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31_4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31271
# gear_intellect=10246
# gear_crit_rating=2907
# gear_haste_rating=3817
# gear_mastery_rating=7080
# gear_versatility_rating=793
# gear_armor=4652
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 9408
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.7 )

Performance:

Total Events Processed: 926354232
Max Event Queue: 108
Sim Seconds: 2819483
CPU Seconds: 828.8347
Physical Seconds: 31.8328
Speed Up: 3402

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
447 T30 4p 447 T30 4p astral_smolder ticks -394061 23541404 78471 140.51 33508 0 341.9 702.5 0.0% 0.0% 0.0% 0.0% 0.94sec 23541404 299.62sec
447 T30 4p 447 T30 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
447 T30 4p 447 T30 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
447 T30 4p 447 T30 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
447 T30 4p 447 T30 4p fury_of_elune 202770 5972752 19935 151.10 5004 10580 5.1 754.5 52.2% 0.0% 0.0% 0.0% 64.79sec 5972752 299.62sec
447 T30 4p 447 T30 4p hungering_shadowflame 424324 889101 2967 3.37 41606 82781 16.8 16.8 27.2% 0.0% 0.0% 0.0% 17.58sec 889101 299.62sec
447 T30 4p 447 T30 4p hungering_shadowflame_self 424324 512031 1709 3.37 23897 47778 16.8 16.8 27.3% 0.0% 0.0% 0.0% 17.58sec 578440 299.62sec
447 T30 4p 447 T30 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.86sec 0 299.62sec
447 T30 4p 447 T30 4p launched_thorns 379403 858736 2866 6.73 20064 40108 33.7 33.6 27.3% 0.0% 0.0% 0.0% 8.59sec 858736 299.62sec
447 T30 4p 447 T30 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 67.76sec 0 299.62sec
447 T30 4p 447 T30 4p moonfire 8921 63258 211 1.20 7108 14209 3.0 6.0 48.4% 0.0% 0.0% 0.0% 1.06sec 21133163 299.62sec
447 T30 4p 447 T30 4p moonfire ticks -8921 21069905 70233 359.19 8296 16825 3.0 1795.9 40.3% 0.0% 0.0% 0.0% 1.06sec 21133163 299.62sec
447 T30 4p 447 T30 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
447 T30 4p 447 T30 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 299.62sec
447 T30 4p 447 T30 4p overwhelming_rage ticks -374037 593121 1977 3.95 30025 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.70sec 669816 299.62sec
447 T30 4p 447 T30 4p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.35sec 0 299.62sec
447 T30 4p 447 T30 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
447 T30 4p 447 T30 4p shooting_stars_moonfire 202497 4119685 13750 36.66 14462 30424 183.5 183.0 50.4% 0.0% 0.0% 0.0% 1.82sec 4119685 299.62sec
447 T30 4p 447 T30 4p shooting_stars_sunfire 202497 4133663 13796 36.90 14427 30338 184.7 184.3 50.3% 0.0% 0.0% 0.0% 1.81sec 4133663 299.62sec
447 T30 4p 447 T30 4p orbit_breaker 274283 8768529 29266 18.40 61345 128955 15.4 91.9 50.4% 0.0% 0.0% 0.0% 19.71sec 8768529 299.62sec
447 T30 4p 447 T30 4p crashing_star 408310 7712340 25741 18.40 53913 113340 92.1 91.9 50.5% 0.0% 0.0% 0.0% 3.32sec 7712340 299.62sec
447 T30 4p 447 T30 4p starfall 191034 66786754 222907 353.86 25399 53719 105.1 1767.1 43.8% 0.0% 0.0% 0.0% 2.82sec 66786754 299.62sec
447 T30 4p 447 T30 4p starfire 194153 39395322 131485 129.60 39687 81015 106.9 647.2 51.3% 0.0% 0.0% 0.0% 2.74sec 39395322 299.62sec
447 T30 4p 447 T30 4p sunfire 93402 7155 24 0.20 5597 11191 1.0 1.0 27.8% 0.0% 0.0% 0.0% 0.00sec 18035505 299.62sec
447 T30 4p 447 T30 4p sunfire ticks -93402 18028350 60095 361.78 7142 14851 1.0 1808.9 36.6% 0.0% 0.0% 0.0% 0.00sec 18035505 299.62sec
447 T30 4p 447 T30 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 31.87sec 0 299.62sec
447 T30 4p 447 T30 4p denizen_of_the_flame 426486 854033 2850 9.96 13511 27003 8.3 49.8 27.1% 0.0% 0.0% 0.0% 31.87sec 854033 299.62sec
447 T30 4p 447 T30 4p denizen_of_the_flame_secondary 426431 780981 2607 19.12 6428 12847 15.9 95.5 27.3% 0.0% 0.0% 0.0% 15.60sec 780981 299.62sec
447 T30 4p 447 T30 4p wrath 190984 627127 2093 5.24 17245 34481 26.3 26.2 38.9% 0.0% 0.0% 0.0% 10.44sec 627127 299.62sec
447+460 2p_2p 447+460 2p_2p astral_smolder ticks -394061 29529231 98431 146.92 40200 0 373.3 734.6 0.0% 0.0% 0.0% 0.0% 0.86sec 29529231 299.94sec
447+460 2p_2p 447+460 2p_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p fury_of_elune 202770 6015994 20057 150.83 5064 10757 5.1 754.0 51.2% 0.0% 0.0% 0.0% 64.76sec 6015994 299.94sec
447+460 2p_2p 447+460 2p_2p hungering_shadowflame 424324 893208 2978 3.38 41306 83171 16.9 16.9 27.6% 0.0% 0.0% 0.0% 16.82sec 893208 299.94sec
447+460 2p_2p 447+460 2p_2p hungering_shadowflame_self 424324 514502 1715 3.38 23897 47781 16.9 16.9 27.4% 0.0% 0.0% 0.0% 16.82sec 581242 299.94sec
447+460 2p_2p 447+460 2p_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.06sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p launched_thorns 379403 861813 2873 6.75 20062 40100 33.8 33.7 27.3% 0.0% 0.0% 0.0% 8.62sec 861813 299.94sec
447+460 2p_2p 447+460 2p_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 48.40sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p moonfire 8921 64277 214 1.20 7213 14416 3.0 6.0 48.6% 0.0% 0.0% 0.0% 1.08sec 21649743 299.94sec
447+460 2p_2p 447+460 2p_2p moonfire ticks -8921 21585466 71952 360.11 8451 17148 3.0 1800.6 40.7% 0.0% 0.0% 0.0% 1.08sec 21649743 299.94sec
447+460 2p_2p 447+460 2p_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.40sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p overwhelming_rage ticks -374037 602814 2009 3.92 30786 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.01sec 680732 299.94sec
447+460 2p_2p 447+460 2p_2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.32sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p shooting_stars_moonfire 202497 5305118 17687 46.42 14677 30902 232.7 232.1 50.4% 0.0% 0.0% 0.0% 1.48sec 5305118 299.94sec
447+460 2p_2p 447+460 2p_2p shooting_stars_sunfire 202497 5323695 17749 46.74 14636 30813 234.2 233.6 50.4% 0.0% 0.0% 0.0% 1.48sec 5323695 299.94sec
447+460 2p_2p 447+460 2p_2p orbit_breaker 274283 8991160 29977 18.63 62160 130893 15.6 93.1 50.1% 0.0% 0.0% 0.0% 19.48sec 8991160 299.94sec
447+460 2p_2p 447+460 2p_2p starfall 191034 67142332 223854 353.85 25408 53912 103.5 1768.9 44.0% 0.0% 0.0% 0.0% 2.87sec 67142332 299.94sec
447+460 2p_2p 447+460 2p_2p starfire 194153 48797459 162692 141.19 43774 93078 116.6 705.8 51.4% 0.0% 0.0% 0.0% 2.53sec 48797459 299.94sec
447+460 2p_2p 447+460 2p_2p sunfire 93402 7262 24 0.20 5677 11353 1.0 1.0 27.9% 0.0% 0.0% 0.0% 0.00sec 18401049 299.94sec
447+460 2p_2p 447+460 2p_2p sunfire ticks -93402 18393786 61313 362.70 7246 15107 1.0 1813.5 36.9% 0.0% 0.0% 0.0% 0.00sec 18401049 299.94sec
447+460 2p_2p 447+460 2p_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.36sec 0 299.94sec
447+460 2p_2p 447+460 2p_2p denizen_of_the_flame 426486 860430 2869 9.99 13509 27001 8.3 50.0 27.5% 0.0% 0.0% 0.0% 32.36sec 860430 299.94sec
447+460 2p_2p 447+460 2p_2p denizen_of_the_flame_secondary 426431 785319 2618 19.21 6427 12845 16.0 96.0 27.3% 0.0% 0.0% 0.0% 15.82sec 785319 299.94sec
447+460 2p_2p 447+460 2p_2p wrath 190984 1050782 3503 5.19 29103 58155 26.1 26.0 39.2% 0.0% 0.0% 0.0% 10.48sec 1050782 299.94sec
447+470 2p_2p 447+470 2p_2p astral_smolder ticks -394061 29968411 99895 147.32 40685 0 374.8 736.6 0.0% 0.0% 0.0% 0.0% 0.86sec 29968411 300.17sec
447+470 2p_2p 447+470 2p_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p fury_of_elune 202770 6123856 20401 151.35 5129 10884 5.1 757.2 51.4% 0.0% 0.0% 0.0% 64.76sec 6123856 300.17sec
447+470 2p_2p 447+470 2p_2p hungering_shadowflame 424324 896899 2988 3.38 41508 83535 16.9 16.9 27.6% 0.0% 0.0% 0.0% 17.15sec 896899 300.17sec
447+470 2p_2p 447+470 2p_2p hungering_shadowflame_self 424324 514799 1715 3.38 23898 47779 16.9 16.9 27.5% 0.0% 0.0% 0.0% 17.15sec 581587 300.17sec
447+470 2p_2p 447+470 2p_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p launched_thorns 379403 862132 2872 6.74 20062 40101 33.8 33.7 27.4% 0.0% 0.0% 0.0% 8.70sec 862132 300.17sec
447+470 2p_2p 447+470 2p_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 55.71sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p moonfire 8921 65056 217 1.20 7298 14594 3.0 6.0 48.6% 0.0% 0.0% 0.0% 1.09sec 21954897 300.17sec
447+470 2p_2p 447+470 2p_2p moonfire ticks -8921 21889841 72966 360.71 8549 17344 3.0 1803.5 40.8% 0.0% 0.0% 0.0% 1.09sec 21954897 300.17sec
447+470 2p_2p 447+470 2p_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.44sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p overwhelming_rage ticks -374037 618945 2063 3.94 31452 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.28sec 698987 300.17sec
447+470 2p_2p 447+470 2p_2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.63sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p shooting_stars_moonfire 202497 5378439 17918 46.46 14859 31271 233.1 232.5 50.4% 0.0% 0.0% 0.0% 1.48sec 5378439 300.17sec
447+470 2p_2p 447+470 2p_2p shooting_stars_sunfire 202497 5407569 18015 46.81 14821 31191 234.8 234.2 50.5% 0.0% 0.0% 0.0% 1.48sec 5407569 300.17sec
447+470 2p_2p 447+470 2p_2p orbit_breaker 274283 9139168 30446 18.65 62954 132589 15.6 93.3 50.3% 0.0% 0.0% 0.0% 19.38sec 9139168 300.17sec
447+470 2p_2p 447+470 2p_2p starfall 191034 68139060 227000 353.83 25744 54622 103.7 1770.2 44.2% 0.0% 0.0% 0.0% 2.87sec 68139060 300.17sec
447+470 2p_2p 447+470 2p_2p starfire 194153 49457180 164763 141.32 44266 94087 116.8 707.0 51.6% 0.0% 0.0% 0.0% 2.53sec 49457180 300.17sec
447+470 2p_2p 447+470 2p_2p sunfire 93402 7325 24 0.20 5746 11489 1.0 1.0 27.5% 0.0% 0.0% 0.0% 0.00sec 18662462 300.17sec
447+470 2p_2p 447+470 2p_2p sunfire ticks -93402 18655137 62184 363.29 7329 15280 1.0 1816.4 37.0% 0.0% 0.0% 0.0% 0.00sec 18662462 300.17sec
447+470 2p_2p 447+470 2p_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.41sec 0 300.17sec
447+470 2p_2p 447+470 2p_2p denizen_of_the_flame 426486 859104 2862 9.97 13509 26996 8.3 49.9 27.5% 0.0% 0.0% 0.0% 32.41sec 859104 300.17sec
447+470 2p_2p 447+470 2p_2p denizen_of_the_flame_secondary 426431 785734 2618 19.16 6428 12848 16.0 95.9 27.5% 0.0% 0.0% 0.0% 15.81sec 785734 300.17sec
447+470 2p_2p 447+470 2p_2p wrath 190984 1066842 3554 5.19 29437 58833 26.1 26.0 39.5% 0.0% 0.0% 0.0% 10.48sec 1066842 300.17sec
460 T31_2p 460 T31_2p astral_smolder ticks -394061 30136659 100456 146.85 41046 0 373.4 734.2 0.0% 0.0% 0.0% 0.0% 0.86sec 30136659 299.45sec
460 T31_2p 460 T31_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.45sec
460 T31_2p 460 T31_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.45sec
460 T31_2p 460 T31_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.45sec
460 T31_2p 460 T31_2p fury_of_elune 202770 6169539 20603 151.56 5175 10974 5.1 756.4 51.4% 0.0% 0.0% 0.0% 64.79sec 6169539 299.45sec
460 T31_2p 460 T31_2p hungering_shadowflame 424324 899230 3003 3.38 41830 83736 16.9 16.9 27.4% 0.0% 0.0% 0.0% 17.08sec 899230 299.45sec
460 T31_2p 460 T31_2p hungering_shadowflame_self 424324 513272 1714 3.38 23915 47819 16.9 16.9 27.2% 0.0% 0.0% 0.0% 17.08sec 580516 299.45sec
460 T31_2p 460 T31_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 299.45sec
460 T31_2p 460 T31_2p launched_thorns 379403 862260 2879 6.75 20103 40168 33.8 33.7 27.3% 0.0% 0.0% 0.0% 8.72sec 862260 299.45sec
460 T31_2p 460 T31_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 27.29sec 0 299.45sec
460 T31_2p 460 T31_2p moonfire 8921 54634 182 1.20 6137 12268 3.0 6.0 48.4% 0.0% 0.0% 0.0% 1.08sec 18421107 299.45sec
460 T31_2p 460 T31_2p moonfire ticks -8921 18366473 61222 360.31 7188 14581 3.0 1801.5 40.7% 0.0% 0.0% 0.0% 1.08sec 18421107 299.45sec
460 T31_2p 460 T31_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.45sec
460 T31_2p 460 T31_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.40sec 0 299.45sec
460 T31_2p 460 T31_2p overwhelming_rage ticks -374037 630645 2102 3.96 31825 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.83sec 712907 299.45sec
460 T31_2p 460 T31_2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.70sec 0 299.45sec
460 T31_2p 460 T31_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.45sec
460 T31_2p 460 T31_2p shooting_stars_moonfire 202497 4518020 15088 46.53 12500 26299 232.8 232.2 50.4% 0.0% 0.0% 0.0% 1.48sec 4518020 299.45sec
460 T31_2p 460 T31_2p shooting_stars_sunfire 202497 4539194 15158 46.91 12468 26223 234.7 234.1 50.3% 0.0% 0.0% 0.0% 1.48sec 4539194 299.45sec
460 T31_2p 460 T31_2p orbit_breaker 274283 9199232 30720 18.67 63596 133654 15.6 93.2 50.1% 0.0% 0.0% 0.0% 19.42sec 9199232 299.45sec
460 T31_2p 460 T31_2p starfall 191034 68668876 229314 353.83 26033 55223 103.6 1765.9 44.0% 0.0% 0.0% 0.0% 2.87sec 68668876 299.45sec
460 T31_2p 460 T31_2p starfire 194153 49816023 166356 141.48 44700 94941 116.7 706.1 51.5% 0.0% 0.0% 0.0% 2.53sec 49816023 299.45sec
460 T31_2p 460 T31_2p sunfire 93402 6151 21 0.20 4833 9663 1.0 1.0 27.3% 0.0% 0.0% 0.0% 0.00sec 15658980 299.45sec
460 T31_2p 460 T31_2p sunfire ticks -93402 15652829 52176 362.90 6163 12847 1.0 1814.5 36.9% 0.0% 0.0% 0.0% 0.00sec 15658980 299.45sec
460 T31_2p 460 T31_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.79sec 0 299.45sec
460 T31_2p 460 T31_2p denizen_of_the_flame 426486 858947 2868 9.99 13538 27052 8.3 49.9 27.3% 0.0% 0.0% 0.0% 32.79sec 858947 299.45sec
460 T31_2p 460 T31_2p denizen_of_the_flame_secondary 426431 786189 2625 19.21 6441 12873 16.0 95.9 27.4% 0.0% 0.0% 0.0% 15.93sec 786189 299.45sec
460 T31_2p 460 T31_2p wrath 190984 1072349 3581 5.20 29695 59386 26.1 26.0 39.1% 0.0% 0.0% 0.0% 10.47sec 1072349 299.45sec
460 T31_4p 460 T31_4p astral_smolder ticks -394061 34127248 113757 146.84 46484 0 373.3 734.2 0.0% 0.0% 0.0% 0.0% 0.86sec 34127248 299.59sec
460 T31_4p 460 T31_4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
460 T31_4p 460 T31_4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
460 T31_4p 460 T31_4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
460 T31_4p 460 T31_4p fury_of_elune 202770 6733806 22477 151.48 5694 11949 5.1 756.3 51.3% 0.0% 0.0% 0.0% 64.92sec 6733806 299.59sec
460 T31_4p 460 T31_4p hungering_shadowflame 424324 895608 2989 3.38 41751 83383 16.9 16.9 27.3% 0.0% 0.0% 0.0% 16.95sec 895608 299.59sec
460 T31_4p 460 T31_4p hungering_shadowflame_self 424324 513534 1714 3.38 23909 47799 16.9 16.9 27.4% 0.0% 0.0% 0.0% 16.95sec 580536 299.59sec
460 T31_4p 460 T31_4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 299.59sec
460 T31_4p 460 T31_4p launched_thorns 379403 861530 2876 6.75 20087 40143 33.8 33.7 27.3% 0.0% 0.0% 0.0% 8.65sec 861530 299.59sec
460 T31_4p 460 T31_4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 281.00sec 0 299.59sec
460 T31_4p 460 T31_4p moonfire 8921 54113 181 1.20 6097 12181 3.0 6.0 48.0% 0.0% 0.0% 0.0% 1.11sec 19267508 299.59sec
460 T31_4p 460 T31_4p moonfire ticks -8921 19213395 64045 360.20 7525 15250 3.0 1801.0 40.7% 0.0% 0.0% 0.0% 1.11sec 19267508 299.59sec
460 T31_4p 460 T31_4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
460 T31_4p 460 T31_4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.42sec 0 299.59sec
460 T31_4p 460 T31_4p overwhelming_rage ticks -374037 617502 2058 3.94 31337 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 61.14sec 697789 299.59sec
460 T31_4p 460 T31_4p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.50sec 0 299.59sec
460 T31_4p 460 T31_4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
460 T31_4p 460 T31_4p shooting_stars_moonfire 202497 4852578 16197 46.50 13403 28281 232.8 232.2 50.4% 0.0% 0.0% 0.0% 1.48sec 4852578 299.59sec
460 T31_4p 460 T31_4p shooting_stars_sunfire 202497 4871164 16259 46.84 13367 28183 234.5 233.9 50.4% 0.0% 0.0% 0.0% 1.48sec 4871164 299.59sec
460 T31_4p 460 T31_4p orbit_breaker 274283 9900379 33046 18.66 68184 144193 15.6 93.2 50.1% 0.0% 0.0% 0.0% 19.38sec 9900379 299.59sec
460 T31_4p 460 T31_4p starfall 191034 75146926 250832 353.83 28483 60394 103.6 1766.7 44.0% 0.0% 0.0% 0.0% 2.87sec 75146926 299.59sec
460 T31_4p 460 T31_4p starfire 194153 51825182 172987 141.38 46632 98704 116.7 706.0 51.4% 0.0% 0.0% 0.0% 2.53sec 51825182 299.59sec
460 T31_4p 460 T31_4p sunfire 93402 6099 20 0.20 4786 9569 1.0 1.0 27.5% 0.0% 0.0% 0.0% 0.00sec 16127859 299.59sec
460 T31_4p 460 T31_4p sunfire ticks -93402 16121760 53739 362.78 6327 13276 1.0 1813.9 36.9% 0.0% 0.0% 0.0% 0.00sec 16127859 299.59sec
460 T31_4p 460 T31_4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.36sec 0 299.59sec
460 T31_4p 460 T31_4p denizen_of_the_flame 426486 860341 2872 10.01 13529 27033 8.3 50.0 27.3% 0.0% 0.0% 0.0% 32.36sec 860341 299.59sec
460 T31_4p 460 T31_4p denizen_of_the_flame_secondary 426431 787356 2628 19.25 6437 12863 16.0 96.1 27.3% 0.0% 0.0% 0.0% 15.70sec 787356 299.59sec
460 T31_4p 460 T31_4p wrath 190984 1063784 3551 5.20 29441 58699 26.1 26.0 39.4% 0.0% 0.0% 0.0% 10.46sec 1063784 299.59sec
470 T31_2p 470 T31_2p astral_smolder ticks -394061 30646667 102156 147.20 41641 0 375.4 736.0 0.0% 0.0% 0.0% 0.0% 0.85sec 30646667 299.49sec
470 T31_2p 470 T31_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
470 T31_2p 470 T31_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
470 T31_2p 470 T31_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
470 T31_2p 470 T31_2p fury_of_elune 202770 6263599 20914 151.52 5246 11114 5.1 756.3 51.7% 0.0% 0.0% 0.0% 64.69sec 6263599 299.49sec
470 T31_2p 470 T31_2p hungering_shadowflame 424324 897645 2997 3.39 41753 83177 16.9 16.9 27.4% 0.0% 0.0% 0.0% 16.74sec 897645 299.49sec
470 T31_2p 470 T31_2p hungering_shadowflame_self 424324 514795 1719 3.39 23916 47814 16.9 16.9 27.4% 0.0% 0.0% 0.0% 16.74sec 582213 299.49sec
470 T31_2p 470 T31_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.12sec 0 299.49sec
470 T31_2p 470 T31_2p launched_thorns 379403 864872 2888 6.76 20103 40176 33.8 33.7 27.6% 0.0% 0.0% 0.0% 8.77sec 864872 299.49sec
470 T31_2p 470 T31_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 26.00sec 0 299.49sec
470 T31_2p 470 T31_2p moonfire 8921 55286 185 1.20 6215 12422 3.0 6.0 48.3% 0.0% 0.0% 0.0% 1.09sec 18685980 299.49sec
470 T31_2p 470 T31_2p moonfire ticks -8921 18630694 62102 360.96 7270 14746 3.0 1804.8 40.8% 0.0% 0.0% 0.0% 1.09sec 18685980 299.49sec
470 T31_2p 470 T31_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
470 T31_2p 470 T31_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.44sec 0 299.49sec
470 T31_2p 470 T31_2p overwhelming_rage ticks -374037 640683 2136 3.94 32486 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 61.72sec 724378 299.49sec
470 T31_2p 470 T31_2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.45sec 0 299.49sec
470 T31_2p 470 T31_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
470 T31_2p 470 T31_2p shooting_stars_moonfire 202497 4595828 15345 46.71 12655 26608 233.7 233.1 50.6% 0.0% 0.0% 0.0% 1.48sec 4595828 299.49sec
470 T31_2p 470 T31_2p shooting_stars_sunfire 202497 4611204 15397 47.02 12621 26534 235.3 234.7 50.5% 0.0% 0.0% 0.0% 1.48sec 4611204 299.49sec
470 T31_2p 470 T31_2p orbit_breaker 274283 9367506 31278 18.76 64376 135346 15.7 93.6 50.3% 0.0% 0.0% 0.0% 19.35sec 9367506 299.49sec
470 T31_2p 470 T31_2p starfall 191034 69743456 232872 353.85 26420 55966 103.9 1766.3 44.2% 0.0% 0.0% 0.0% 2.86sec 69743456 299.49sec
470 T31_2p 470 T31_2p starfire 194153 50569064 168849 141.62 45304 96089 116.8 706.9 51.7% 0.0% 0.0% 0.0% 2.53sec 50569064 299.49sec
470 T31_2p 470 T31_2p sunfire 93402 6249 21 0.20 4890 9780 1.0 1.0 27.8% 0.0% 0.0% 0.0% 0.00sec 15879591 299.49sec
470 T31_2p 470 T31_2p sunfire ticks -93402 15873341 52911 363.55 6235 12989 1.0 1817.7 37.0% 0.0% 0.0% 0.0% 0.00sec 15879591 299.49sec
470 T31_2p 470 T31_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 32.34sec 0 299.49sec
470 T31_2p 470 T31_2p denizen_of_the_flame 426486 864570 2887 10.05 13537 27050 8.4 50.1 27.4% 0.0% 0.0% 0.0% 32.34sec 864570 299.49sec
470 T31_2p 470 T31_2p denizen_of_the_flame_secondary 426431 790881 2641 19.30 6441 12872 16.1 96.3 27.5% 0.0% 0.0% 0.0% 15.74sec 790881 299.49sec
470 T31_2p 470 T31_2p wrath 190984 1090906 3643 5.22 30096 59934 26.2 26.1 39.4% 0.0% 0.0% 0.0% 10.45sec 1090906 299.49sec
470 T31_4p 470 T31_4p astral_smolder ticks -394061 35047714 116826 147.20 47621 0 375.2 736.0 0.0% 0.0% 0.0% 0.0% 0.85sec 35047714 299.59sec
470 T31_4p 470 T31_4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
470 T31_4p 470 T31_4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
470 T31_4p 470 T31_4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
470 T31_4p 470 T31_4p fury_of_elune 202770 6907516 23056 151.58 5825 12204 5.1 756.9 51.8% 0.0% 0.0% 0.0% 64.71sec 6907516 299.59sec
470 T31_4p 470 T31_4p hungering_shadowflame 424324 900332 3005 3.40 41740 82892 17.0 17.0 27.6% 0.0% 0.0% 0.0% 16.82sec 900332 299.59sec
470 T31_4p 470 T31_4p hungering_shadowflame_self 424324 517145 1726 3.40 23916 47819 17.0 17.0 27.5% 0.0% 0.0% 0.0% 16.82sec 584923 299.59sec
470 T31_4p 470 T31_4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 299.59sec
470 T31_4p 470 T31_4p launched_thorns 379403 866769 2893 6.78 20103 40178 33.9 33.8 27.4% 0.0% 0.0% 0.0% 8.69sec 866769 299.59sec
470 T31_4p 470 T31_4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 135.00sec 0 299.59sec
470 T31_4p 470 T31_4p moonfire 8921 55433 185 1.20 6232 12452 3.0 6.0 48.3% 0.0% 0.0% 0.0% 1.09sec 19737236 299.59sec
470 T31_4p 470 T31_4p moonfire ticks -8921 19681803 65606 361.08 7684 15562 3.0 1805.4 40.8% 0.0% 0.0% 0.0% 1.09sec 19737236 299.59sec
470 T31_4p 470 T31_4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
470 T31_4p 470 T31_4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 299.59sec
470 T31_4p 470 T31_4p overwhelming_rage ticks -374037 633537 2112 3.90 32489 0 4.0 19.5 0.0% 0.0% 0.0% 0.0% 58.74sec 716241 299.59sec
470 T31_4p 470 T31_4p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.45sec 0 299.59sec
470 T31_4p 470 T31_4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.59sec
470 T31_4p 470 T31_4p shooting_stars_moonfire 202497 4979788 16622 46.65 13704 28882 233.5 232.9 50.6% 0.0% 0.0% 0.0% 1.48sec 4979788 299.59sec
470 T31_4p 470 T31_4p shooting_stars_sunfire 202497 5001472 16694 47.02 13665 28791 235.4 234.8 50.5% 0.0% 0.0% 0.0% 1.48sec 5001472 299.59sec
470 T31_4p 470 T31_4p orbit_breaker 274283 10171065 33950 18.72 69673 147311 15.6 93.5 50.4% 0.0% 0.0% 0.0% 19.42sec 10171065 299.59sec
470 T31_4p 470 T31_4p starfall 191034 77125984 257437 353.85 29209 61870 103.9 1766.8 44.2% 0.0% 0.0% 0.0% 2.87sec 77125984 299.59sec
470 T31_4p 470 T31_4p starfire 194153 53122973 177318 141.63 47689 100838 116.9 707.2 51.6% 0.0% 0.0% 0.0% 2.53sec 53122973 299.59sec
470 T31_4p 470 T31_4p sunfire 93402 6236 21 0.20 4890 9778 1.0 1.0 27.5% 0.0% 0.0% 0.0% 0.00sec 16523534 299.59sec
470 T31_4p 470 T31_4p sunfire ticks -93402 16517298 55058 363.68 6461 13546 1.0 1818.4 37.0% 0.0% 0.0% 0.0% 0.00sec 16523534 299.59sec
470 T31_4p 470 T31_4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 33.31sec 0 299.59sec
470 T31_4p 470 T31_4p denizen_of_the_flame 426486 862974 2881 10.02 13535 27052 8.3 50.0 27.5% 0.0% 0.0% 0.0% 33.31sec 862974 299.59sec
470 T31_4p 470 T31_4p denizen_of_the_flame_secondary 426431 789045 2634 19.25 6441 12872 16.0 96.1 27.5% 0.0% 0.0% 0.0% 16.19sec 789045 299.59sec
470 T31_4p 470 T31_4p wrath 190984 1091085 3642 5.22 30065 59980 26.2 26.1 39.4% 0.0% 0.0% 0.0% 10.43sec 1091085 299.59sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
124523.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 3.2s 0.0s 297.5s 99.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.7s / 359.1s
  • uptime_min/max:92.16% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.28%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.3s 0.0s 298.3s 99.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 5.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.5s / 359.0s
  • uptime_min/max:90.27% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.36%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.3s 0.0s 298.0s 99.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.9s / 359.0s
  • uptime_min/max:89.80% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.36%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.2s 0.0s 297.6s 99.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.0s / 359.0s
  • uptime_min/max:90.66% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.1s 0.0s 297.6s 99.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 18.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.0s / 359.0s
  • uptime_min/max:92.17% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.0s 0.0s 297.7s 99.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.7s / 359.0s
  • uptime_min/max:91.01% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.36%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.0s 0.0s 297.7s 99.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.9s / 359.1s
  • uptime_min/max:91.27% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
Fluffy_Pillow Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 58241
Mean 132926.02
Minimum 109038.35
Maximum 163035.48
Spread ( max - min ) 53997.13
Range [ ( max - min ) / 2 * 100% ] 20.31%
Standard Deviation 7151.1461
5th Percentile 121110.49
95th Percentile 145088.29
( 95th Percentile - 5th Percentile ) 23977.80
Mean Distribution
Standard Deviation 29.6320
95.00% Confidence Interval ( 132867.94 - 132984.10 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11119
0.1 Scale Factor Error with Delta=300 436551
0.05 Scale Factor Error with Delta=300 1746204
0.01 Scale Factor Error with Delta=300 43655099
HPS
Fluffy_Pillow Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 41620058 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
112023.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.4s 0.0s 295.2s 98.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.7s / 359.1s
  • uptime_min/max:90.62% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.50%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.2s 0.0s 296.3s 98.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:220.3s / 359.0s
  • uptime_min/max:90.96% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.68%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 296.0s 98.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.3s / 358.9s
  • uptime_min/max:91.07% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.67%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.8s 0.0s 295.7s 98.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:220.0s / 358.8s
  • uptime_min/max:90.97% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.71%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.9s 0.0s 295.5s 98.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.6s / 358.9s
  • uptime_min/max:90.55% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.67%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.4s 0.0s 295.7s 98.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.8s / 359.0s
  • uptime_min/max:90.75% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.68%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.6s 0.0s 295.7s 98.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.0s / 359.1s
  • uptime_min/max:89.93% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.67%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
enemy2 Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 58241
Mean 119580.10
Minimum 100840.45
Maximum 146118.86
Spread ( max - min ) 45278.41
Range [ ( max - min ) / 2 * 100% ] 18.93%
Standard Deviation 6263.1443
5th Percentile 110006.04
95th Percentile 130569.04
( 95th Percentile - 5th Percentile ) 20563.00
Mean Distribution
Standard Deviation 25.9524
95.00% Confidence Interval ( 119529.24 - 119630.97 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10539
0.1 Scale Factor Error with Delta=300 334865
0.05 Scale Factor Error with Delta=300 1339457
0.01 Scale Factor Error with Delta=300 33486404
HPS
enemy2 Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 43636711 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy2"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
111908.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 5.1s 0.0s 294.9s 98.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:215.6s / 358.9s
  • uptime_min/max:89.34% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.39%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 296.0s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.8s / 358.7s
  • uptime_min/max:92.10% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 295.7s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:217.1s / 358.9s
  • uptime_min/max:89.82% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.3s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.1s / 358.7s
  • uptime_min/max:89.84% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.5s 0.0s 295.3s 98.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.5s / 358.9s
  • uptime_min/max:90.47% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.58%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.2s 0.0s 295.4s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 23.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.6s / 358.8s
  • uptime_min/max:90.68% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.3s 0.0s 295.4s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.0s / 358.9s
  • uptime_min/max:90.80% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
enemy3 Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 58241
Mean 119503.23
Minimum 100582.99
Maximum 144435.22
Spread ( max - min ) 43852.23
Range [ ( max - min ) / 2 * 100% ] 18.35%
Standard Deviation 6271.4875
5th Percentile 109935.23
95th Percentile 130493.54
( 95th Percentile - 5th Percentile ) 20558.31
Mean Distribution
Standard Deviation 25.9870
95.00% Confidence Interval ( 119452.30 - 119554.17 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10580
0.1 Scale Factor Error with Delta=300 335757
0.05 Scale Factor Error with Delta=300 1343028
0.01 Scale Factor Error with Delta=300 33575679
HPS
enemy3 Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 35312684 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy3"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
111739.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 5.1s 0.0s 294.8s 98.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.9s / 358.8s
  • uptime_min/max:89.31% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 295.9s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.9s / 358.8s
  • uptime_min/max:92.64% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.8s 0.0s 295.6s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.4s / 359.0s
  • uptime_min/max:89.38% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.8s 0.0s 295.3s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.7s / 358.9s
  • uptime_min/max:90.69% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.1s 0.0s 295.2s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.5s / 359.0s
  • uptime_min/max:89.62% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 295.4s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 18.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:218.1s / 359.0s
  • uptime_min/max:90.59% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.8s 0.0s 295.3s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.7s / 358.9s
  • uptime_min/max:90.94% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
enemy4 Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 58241
Mean 119423.32
Minimum 99019.22
Maximum 144540.67
Spread ( max - min ) 45521.45
Range [ ( max - min ) / 2 * 100% ] 19.06%
Standard Deviation 6253.6472
5th Percentile 109876.55
95th Percentile 130412.33
( 95th Percentile - 5th Percentile ) 20535.78
Mean Distribution
Standard Deviation 25.9131
95.00% Confidence Interval ( 119372.53 - 119474.11 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10534
0.1 Scale Factor Error with Delta=300 333850
0.05 Scale Factor Error with Delta=300 1335398
0.01 Scale Factor Error with Delta=300 33384927
HPS
enemy4 Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 36990864 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy4"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
111611.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 5.3s 0.0s 294.8s 98.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.8s / 358.7s
  • uptime_min/max:90.27% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.3s 0.0s 295.9s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.9s / 358.9s
  • uptime_min/max:91.36% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.2s 0.0s 295.6s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.2s / 358.9s
  • uptime_min/max:91.20% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.9s 0.0s 295.2s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.2s / 358.8s
  • uptime_min/max:87.73% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 295.2s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.9s / 358.9s
  • uptime_min/max:90.16% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.4s 98.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.0s / 358.9s
  • uptime_min/max:90.62% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.58%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.7s 0.0s 295.4s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.2s / 359.1s
  • uptime_min/max:91.05% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
enemy5 Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 58241
Mean 119381.06
Minimum 100614.60
Maximum 147502.71
Spread ( max - min ) 46888.10
Range [ ( max - min ) / 2 * 100% ] 19.64%
Standard Deviation 6276.6615
5th Percentile 109720.35
95th Percentile 130294.57
( 95th Percentile - 5th Percentile ) 20574.21
Mean Distribution
Standard Deviation 26.0084
95.00% Confidence Interval ( 119330.09 - 119432.04 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10619
0.1 Scale Factor Error with Delta=300 336312
0.05 Scale Factor Error with Delta=300 1345245
0.01 Scale Factor Error with Delta=300 33631102
HPS
enemy5 Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 44260671 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy5"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy6 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
112399.5 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.1s 0.0s 294.8s 98.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.8s / 359.0s
  • uptime_min/max:91.57% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.38%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 295.9s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.7s / 359.0s
  • uptime_min/max:91.91% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 295.7s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.8s / 358.9s
  • uptime_min/max:91.51% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.4s 0.0s 295.3s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.4s / 359.0s
  • uptime_min/max:91.42% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 295.2s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:218.0s / 358.9s
  • uptime_min/max:90.58% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.4s 0.0s 295.3s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.7s / 358.0s
  • uptime_min/max:89.78% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 295.4s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.7s / 359.0s
  • uptime_min/max:88.50% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy6 Fight Length
Count 58241
Mean 299.69
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5949
5th Percentile 245.96
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1433
95.00% Confidence Interval ( 299.41 - 299.97 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51189
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
enemy6 Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy6 Priority Target Damage Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy6 Damage Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy6 Damage
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy6 Damage Taken Per Second
Count 58241
Mean 119877.90
Minimum 100563.75
Maximum 143593.54
Spread ( max - min ) 43029.78
Range [ ( max - min ) / 2 * 100% ] 17.95%
Standard Deviation 6289.0655
5th Percentile 110226.24
95th Percentile 130923.39
( 95th Percentile - 5th Percentile ) 20697.15
Mean Distribution
Standard Deviation 26.0598
95.00% Confidence Interval ( 119826.82 - 119928.98 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10573
0.1 Scale Factor Error with Delta=300 337642
0.05 Scale Factor Error with Delta=300 1350567
0.01 Scale Factor Error with Delta=300 33764157
HPS
enemy6 Healing Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy6 Healing Per Second (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy6 Heal
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy6 Healing Taken Per Second
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy6 Theck-Meloree Index
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy6Theck-Meloree Index (Effective)
Count 58241
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy6 Max Spike Value
Count 2066
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 40704702 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy6"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.